KEGG   Mycoplasma genitalium G37: MG_453Help
Entry
MG_453            CDS       T00002                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mge  Mycoplasma genitalium G37
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MG_453 (gtaB)
   00052 Galactose metabolism
    MG_453 (gtaB)
   00500 Starch and sucrose metabolism
    MG_453 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MG_453 (gtaB)
Enzymes [BR:mge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MG_453 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556437..557315
Genome map
AA seq 292 aa AA seqDB search
MKTKIRKAVIPAAGLGVRLLPATKAIPKEMLPLVNKPTIQYIVEEAVKSGIEQILVIVSS
KKTAILDHFDYDLILENALIQKNKLQEHKEIEDIANLAHIFFVRQKNQDGLGDAILFAES
FVGNEDFAVLLGDDVVFSKEPALKQCLEAYYETNCQTIGVQEVDPCHVDKYGIITPEGDY
KNKDLIKVLAMTEKPKPKDAKSNLAILGRYVLKPSIFKALRSVPYGVGGELQLTDGLNFC
LKNENFYARKFTGTRFDVGTKSGFIKANLFTALNNKDISKKEVLELLNLVKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaaataagaaaagcagttattcctgctgctgggttgggtgttaggttacta
ccagcaacaaaagcaattcccaaagagatgttaccattggtaaataaacctactatccaa
tacatagtagaggaagcagttaaaagtggcattgaacagattcttgtcattgtttcatcc
aaaaaaacagctatattagatcattttgattatgatctgatcttagaaaatgccttaatt
caaaaaaataaattgcaggagcataaagagattgaagatattgctaatttagcacatatc
ttttttgttagacaaaaaaatcaagatggtttgggagatgcaatcttgtttgctgaatct
tttgttggtaatgaagactttgcagtattgttaggtgatgatgttgtttttagtaaagaa
cctgctttaaaacaatgcttggaagcttattatgaaactaattgtcaaacaatcggtgta
caagaagtagatccttgtcatgttgataagtatggaattatcacccctgaaggtgattac
aaaaataaagatcttattaaggttttagcaatgactgaaaaacctaaaccaaaagatgct
aaaagtaatttagcaatcttagggcgatatgtactcaaaccatctattttcaaagcactt
agaagtgtaccttatggagttggtggtgagttgcaactaactgatggtttaaatttttgt
ttgaaaaatgaaaacttttatgcaagaaagtttactggtactaggtttgatgttggcaca
aagagtggttttattaaagcaaatttatttactgctttaaacaataaagatattagtaaa
aaagaagttttagaacttttaaatttagttaaagcttaa

DBGET integrated database retrieval system