KEGG   Mycoplasma genitalium G37: MG_473Help
Entry
MG_473            CDS       T00002                                 

Gene name
rpmG-2
Definition
(GenBank) ribosomal protein L33 type 2
  KO
K02913  large subunit ribosomal protein L33
Organism
mge  Mycoplasma genitalium G37
Pathway
mge03010  Ribosome
Module
mge_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MG_473 (rpmG-2)
Ribosome [BR:mge03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MG_473 (rpmG-2)
  Bacteria
    MG_473 (rpmG-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L33 zf-DNL Pollen_Ole_e_I HNH_5
Motif
Other DBs
NCBI-ProteinID: AAC71272
UniProt: Q9ZB82
Position
complement(64367..64513)
Genome map
AA seq 48 aa AA seqDB search
MRKKIIFVCQDCLSRNYVKRWTKQPLQRLIINKYCKQCNQKTKHLDSF
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaaaaagattatttttgtctgtcaagactgtttaagtcgtaactatgtaaaacgg
tgaacaaaacaacctttgcagcgacttatcatcaacaagtactgcaagcagtgcaatcaa
aaaactaagcatctagattctttttaa

DBGET integrated database retrieval system