KEGG   Mycoplasma gallisepticum F: MGF_0062Help
Entry
MGF_0062          CDS       T01924                                 

Gene name
ispE
Definition
(GenBank) diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mgf  Mycoplasma gallisepticum F
Pathway
mgf00900  Terpenoid backbone biosynthesis
mgf01100  Metabolic pathways
mgf01110  Biosynthesis of secondary metabolites
mgf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mgf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGF_0062 (ispE)
Enzymes [BR:mgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MGF_0062 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C69
Motif
Other DBs
NCBI-ProteinID: ADC30959
Position
10770..11555
Genome map
AA seq 261 aa AA seqDB search
MVLKKHPELKSYHLPNCLAYMNHYRSYAKVNFYLKIKEYCPKVKKHKLESKLVLVKDLYD
DLYLEKSNQTKIEYFDQNDNPLTFSDDILVRTKKFLEDKLNQNFEFKAKVIKRIPTLSGL
GSAPSNAAVLINWIYQEYGILNPVSYYEIATELGSDIPFFLSLHDCAIIKNFGDQVEQSI
LDGYEIEKIIFNKQKPSTKKIFELLDYSQIKKENLNDLEQPFFSLFPELLPSFNQLKNDN
NHVVLAGAGSCFVVFRKLNEI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttggttttaaaaaaacatccagagctcaagagttatcacctacccaactgtttagcttat
atgaatcattatcgaagttatgctaaagttaatttttatctaaaaattaaggaatactgt
ccaaaagttaaaaagcataaacttgagtccaagttggttctagttaaagatctttatgat
gatctttatttagaaaaatcgaaccaaactaagattgagtactttgatcaaaatgataac
cctttaacatttagtgatgatattttagttaggactaagaaatttttagaagataagtta
aatcaaaattttgaatttaaagcgaaggtgattaaaagaattccgaccctttctggactt
ggctcagctccaagtaatgcagctgttttgattaattgaatttatcaagaatatggaatc
cttaacccggttagttattatgaaatagccactgagctaggtagtgatattccctttttc
ttatccttacatgattgcgcaattattaagaattttggggatcaagtagaacaatctatt
ttggatgggtatgaaatagaaaagatcatttttaacaaacaaaaacctagtacaaaaaag
atctttgaactattagattattctcaaattaaaaaagaaaatcttaatgatttagaacaa
cctttttttagtttatttcccgaattattaccatcttttaatcaattaaaaaatgacaac
aatcacgttgtgttagcaggagctggaagctgctttgtcgtatttagaaagctaaatgaa
atataa

DBGET integrated database retrieval system