KEGG   Mycoplasma gallisepticum F: MGF_1611Help
Entry
MGF_1611          CDS       T01924                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgf  Mycoplasma gallisepticum F
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGF_1611 (tpiA)
   01230 Biosynthesis of amino acids
    MGF_1611 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGF_1611 (tpiA)
   00051 Fructose and mannose metabolism
    MGF_1611 (tpiA)
   00562 Inositol phosphate metabolism
    MGF_1611 (tpiA)
Enzymes [BR:mgf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MGF_1611 (tpiA)
Exosome [BR:mgf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MGF_1611 (tpiA)
  Exosomal proteins of bladder cancer cells
   MGF_1611 (tpiA)
  Exosomal proteins of melanoma cells
   MGF_1611 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269974..270732
Genome map
AA seq 252 aa AA seqDB search
MNSMKRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVAPVFVHLGLANQLKRNE
CLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRKLFHESDELINQKVKTLLE
NKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSLLKDLIIAYEPVWAIGTGKTA
SSQTAQDAIAYIRTVLGLLSSKTIANELPILYGGSVTPDNVSELLAQKDINGALVGGASL
DPHKFIQLIEAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatgaaaagatacatctttggaaattgaaaaacatataaaactactcaagaa
gttaaagagttttttagtgttttaaatcaaactaagttaaccaaaaacccagacgtggtt
tttggtgttgcaccagtattcgtacatttgggtttggctaatcaattaaaaagaaacgaa
tgtttagttttagctcaagatgctaattatgtaatgaataaagctaacacgggaaccgtt
agttatgaacaattaaaagatattggtgttaattacgtaataattggtcactctgaacga
agaaaattatttcatgaatctgatgaactaattaatcagaaagtaaaaacgctattagaa
aataagatgagaccaattttatgtattggtgaaacgttagaagaatacgaagctaacaag
accaaagctgtacttaaagatcagttagaaaaagatcttaaaggaattgatagttcttta
ttaaaagatctaattattgcttatgaaccagtttgggcgatcggaacaggtaagactgct
tcaagtcaaactgcgcaagatgcaatcgcttatattcgaactgttctaggtttattatca
tcaaaaacgatcgcaaatgagttaccaattttatatggtggatcagttactcctgataat
gtttcagaactgttagcacaaaaagacattaatggagcactagtgggtggagcttcatta
gacccacacaaatttatccaacttattgaagctaaataa

DBGET integrated database retrieval system