KEGG   Mycoplasma gallisepticum F: MGF_2592Help
Entry
MGF_2592          CDS       T01924                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase (E2) component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgf  Mycoplasma gallisepticum F
Pathway
mgf00010  Glycolysis / Gluconeogenesis
mgf00020  Citrate cycle (TCA cycle)
mgf00620  Pyruvate metabolism
mgf01100  Metabolic pathways
mgf01110  Biosynthesis of secondary metabolites
mgf01120  Microbial metabolism in diverse environments
mgf01130  Biosynthesis of antibiotics
mgf01200  Carbon metabolism
Module
mgf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGF_2592 (aceF)
   00020 Citrate cycle (TCA cycle)
    MGF_2592 (aceF)
   00620 Pyruvate metabolism
    MGF_2592 (aceF)
Enzymes [BR:mgf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MGF_2592 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 DUF2118 E3_binding DUF1999
Motif
Other DBs
NCBI-ProteinID: ADC31282
Position
435854..437170
Genome map
AA seq 438 aa AA seqDB search
MFEYKFTDVGEGLHEGVVAQIYVKVGDTIKEGDPMFSVETDKVTTDLPAPEGGKVTAILA
SVGQTVHVGEVMLVLNGDGSSAPAAAPATPAFVAPTPAVTPAPTPAEAAPSGGGGGASVV
GEVKVSNTLFGLFGDQRAASTPTPAPTPAFAPTPVPVATPLAQAVASDLNVNLHNVTPAN
GAKIFSSDVFASAQQSSPAASVAANDNETYKEITSIRKAIAKAMTTAHEEIPATVLTFNF
DVTKLVSYRKQVKDAVLASYNVKLSFLPFLLKAITKAVVAHPIFNSHYDKASNRLVLKKK
INLGIAVDTADGLMVPNIKSAQDKSVIELAREVNNLAEKARSKKIGLADLADGTISVTNF
GSIGALFGTPIIKFPEVAIIATGTVEEKLARTPENQIVIKQIMPITIAADHRWIDGADIG
RFAKTLKEIVENLNGLLI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatataaatttacagacgttggtgaagggctacacgaaggtgttgttgctcaa
atctatgttaaagtaggtgacacaattaaagaaggtgacccaatgttttcagttgaaact
gataaggttacaactgacttaccagctcctgaaggtggaaaagttactgcgatccttgca
tcagtaggacaaactgttcacgttggtgaagtgatgcttgttttaaacggtgatggttca
tcagctccagctgctgcacctgctactccagcttttgtagctcctactccagctgttaca
ccagctcctactcctgctgaagctgctcctagtggtggtggtggtggtgcttcagttgta
ggtgaagttaaagtttcaaacactttatttggattatttggtgatcaacgcgctgcaagt
actccaacaccagctcctactccagcttttgcgccaactccagttccagttgcgactcct
ttagctcaagctgttgctagtgatttaaatgtaaatttacacaacgtaacacctgctaac
ggtgctaaaatattctcaagcgatgtatttgcatcagctcaacaaagttcaccagctgct
agtgtagctgcaaacgataacgaaacttacaaagaaattacatcaattagaaaagcaatt
gctaaagcaatgactactgctcacgaagaaattccagcaactgttttaacattcaacttt
gatgtaactaaattagtatcataccgtaagcaagttaaggatgctgtattagcaagctac
aacgttaaattatcattcttaccattcttattgaaagcaattactaaagctgtagttgct
cacccaattttcaactctcactacgacaaagctagcaaccgtttagtattaaagaaaaag
attaacttaggtattgctgttgatactgctgatggtttaatggttcctaacattaaatca
gcacaagacaaatcagtgattgaacttgctagagaagtaaacaatttagctgaaaaagct
cgttctaagaagatcggtttagctgatttagctgatggtacaatcagtgtaactaacttt
ggttcaatcggggctttatttggtacaccaattattaaattcccagaagttgcaattatt
gctactggtacagtagaagaaaaattagcaagaactcctgaaaaccaaatcgtaattaag
caaattatgccaattacaattgcagctgaccacagatgaatcgatggtgctgatatcggt
agatttgctaaaacattaaaagaaatcgttgaaaatcttaacggtttactaatttaa

DBGET integrated database retrieval system