KEGG   Mycoplasma gallisepticum F: MGF_4446Help
Entry
MGF_4446          CDS       T01924                                 

Gene name
tuf
Definition
translation longation factor Tu (EF-Tu)
Orthology
K02358  
elongation factor Tu
Organism
mgf  Mycoplasma gallisepticum F
Brite
Mitochondrial biogenesis [BR:mgf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MGF_4446 (tuf)
Exosome [BR:mgf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGF_4446 (tuf)
  Exosomal proteins of breast cancer cells
   MGF_4446 (tuf)
  Exosomal proteins of colorectal cancer cells
   MGF_4446 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(754809..755993)
Genome map
AA seq 394 aa AA seqDB search
MAKERFDRSKPHVNIGTIGHIDHGKTTLTAAICTVLSKAGTSEAKKYDEIDAAPEEKARG
ITINTAHVEYATQNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSATDGPMPQTREHI
LLARQVGVPKMVVFLNKCDVADDPEMQELVEMEVRDLLKSYGFDGDNTPVIRGSALGALN
GEPAWEEKIHELMKAVDEYIPTPDREVDKPFLLPIEDTMTITGRGTVVTGRVERGQLKVG
EEVEIVGITDTRKVVVTGIEMFRKELDAAMAGDNAGILLRGVDRKDVQRGQVLAKPGSIT
PHKKFRAEIYALKKDEGGRHTAFLNGYRPQFYFRTTDVTGSIQLKEGTEMVMPGDNTEII
VELISSIACEKGSKFSIREGGRTVGAGTVVEVLE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaggttcgatcgtagtaaacctcacgttaatattggaacaatcggtcat
attgaccacggtaaaactacattaaccgcagcaatttgtaccgtgttatcaaaagctggt
acatctgaagctaaaaaatatgatgaaattgatgctgcaccagaagaaaaagctcgtggg
attacaattaacactgcacacgtagaatacgcaactcaaaatcgtcattatgcacacgtt
gactgtcctggtcacgccgactacgttaaaaacatgattacaggtgctgctcaaatggac
ggtggtatcttagttgtgtctgcaactgatggtccaatgcctcaaactcgtgaacacatc
ctattagctcgccaagttggtgttcctaagatggttgtattcttaaacaaatgtgatgta
gctgatgatccagaaatgcaagaattagttgaaatggaagttagagaccttcttaaatct
tacggattcgatggtgataacactccagtaatcagaggctctgctttaggtgctcttaat
ggcgaacctgcatgagaagaaaaaattcatgaactaatgaaagcagttgatgaatacatc
ccaactcctgaccgtgaagttgataaaccattcttattaccaatcgaagatactatgaca
attactggtcgtggtactgtagtaactggtagagttgaacgtggtcaacttaaagttggt
gaagaagttgaaatcgttggtattactgacactagaaaagtagtagtaactggtattgaa
atgttcagaaaagaactagatgctgctatggctggtgacaacgctgggatcttacttcgt
ggtgtagaccgtaaagatgtacaacgtggtcaagttttagctaaacctggttcaattact
ccacacaagaaattcagagctgaaatttatgcgcttaagaaggatgaaggtggtcgtcac
acagctttcttaaatggttacagacctcaattctacttcagaacaactgacgtaactggt
tcaatccaattaaaagaaggaactgaaatggttatgcctggtgataacacagaaattatc
gttgaattaatttcttcaattgcttgtgaaaaaggttctaagttctctatccgtgaaggt
ggtagaactgtaggtgctggtacagttgtagaagtacttgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system