KEGG   Mycoplasma gallisepticum R(high): MGAH_0157Help
Entry
MGAH_0157         CDS       T01923                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgh  Mycoplasma gallisepticum R(high)
Pathway
mgh00010  Glycolysis / Gluconeogenesis
mgh00030  Pentose phosphate pathway
mgh00051  Fructose and mannose metabolism
mgh00680  Methane metabolism
mgh01100  Metabolic pathways
mgh01110  Biosynthesis of secondary metabolites
mgh01120  Microbial metabolism in diverse environments
mgh01130  Biosynthesis of antibiotics
mgh01200  Carbon metabolism
mgh01230  Biosynthesis of amino acids
mgh03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mgh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAH_0157 (pfkA)
   00030 Pentose phosphate pathway
    MGAH_0157 (pfkA)
   00051 Fructose and mannose metabolism
    MGAH_0157 (pfkA)
   00052 Galactose metabolism
    MGAH_0157 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MGAH_0157 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MGAH_0157 (pfkA)
Enzymes [BR:mgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MGAH_0157 (pfkA)
Protein phosphatases and associated proteins [BR:mgh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MGAH_0157 (pfkA)
Messenger RNA biogenesis [BR:mgh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MGAH_0157 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 DAGK_cat Glycos_transf_1 LYTB
Motif
Other DBs
NCBI-ProteinID: ADC30686
Position
complement(665691..666689)
Genome map
AA seq 332 aa AA seqDB search
MAIQTQRIAILTSGGDSPGMNPAIYGLVQQAIINNIQPYLVYEGYKGLVEDQIVLANQQE
VIDHFFDSGTFIYSARLVEFKDLEVRKKAVSNLKAKKIDTLVVIGGDGSYQGAKLLSEMG
INVIVMPGTIDNDVSSSDYTIGFYSALEHITRTIQEIISTSVSHNRVSISEVMGRHCGDL
AVYAALATKADLVITSENIKTTQEIVDLAAKRMLQDHKRTFTVIVCEHIYGEDGRDSLKT
IAQQINDQLGIKTNLNILTYGQRGQVPTPMERILAMKFAIKAFECINEQRYGVVLGLSGD
EIVAYNFQEALNKRNPSRIKLINLSNRINGGF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccattcaaacacaacgaattgcgatcttaacttctggaggagattctccaggaatg
aatccagcaatttatgggttagttcaacaagcgatcattaataatattcaaccttactta
gtttatgaaggttataaaggcttagttgaagatcagatcgttcttgctaaccaacaagaa
gtgatcgaccatttctttgattcgggaacgtttatttattcagcaagattagttgaattc
aaagatcttgaagtaagaaaaaaagcagtaagtaaccttaaagcaaaaaaaatcgatacg
ttagtagtgatcggtggtgatggttcatatcaaggcgcaaaactattatctgagatgggg
attaatgtgattgtgatgcctggaacgattgataatgatgtatcttcatcagattacaca
atcggtttttattcagcattagaacatattactagaacgattcaagagatcatctcaact
agtgtttctcacaaccgggtatcgatctctgaagtgatgggacgtcattgtggggattta
gcagtttatgcagcacttgcaactaaagctgatctagtaattacctcagaaaatatcaaa
acaacccaagagatcgtagatcttgctgctaaaagaatgttacaagatcacaaacgcaca
tttactgtgatcgtttgtgaacatatttatggtgaagatggcagggatagtttaaaaacg
atcgcccaacagattaatgatcagttaggaattaaaactaatcttaatatcttaacctac
ggtcaacgtggtcaagttcccacaccgatggaacggattctagccatgaaatttgcgatt
aaagcgtttgaatgtattaacgaacaaagatacggcgttgttttaggtttaagtggggat
gagatcgtagcttacaatttccaagaagcactaaataaacgtaatccttcaagaatcaaa
ttaattaatttaagcaatagaataaacggtggtttttaa

DBGET integrated database retrieval system