KEGG   Mycoplasma gallisepticum R(high): MGAH_0399Help
Entry
MGAH_0399         CDS       T01923                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mgh  Mycoplasma gallisepticum R(high)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mgh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(842368..842988)
Genome map
AA seq 206 aa AA seqDB search
MTSDLDLNEFNNLVEQISDLPSVSKKQAKKITQYLMTKSDRYVYDLIDVLKRAKLSIKIC
EMCQGWSNRSICSICSDESRNNNELCIVSFFDDLNVIEESQAYHGKYFILNHEISKKNKR
IIEEINFDLLLDLIKKQKIEKVIIATNFTQDGQTTANYLRFLLDDFDLKIYRLGMGLPYN
SSIDYADSFSLKGAFENKQLIKDKKA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagatctagatctgaatgagtttaataatctagtagaacagattagcgactta
ccaagtgttagtaaaaaacaagccaaaaagattacccaatacttaatgactaaatcagat
cgttatgtttatgatctgattgacgttttaaaacgagctaaattatcaatcaagatctgc
gagatgtgtcagggttgatcaaatcgttctatctgtagtatctgttcagatgaatcaaga
aataacaatgaactgtgtattgttagtttttttgatgatttaaatgtgattgaagaatcc
caagcttatcatggtaagtattttattcttaatcatgagatctctaaaaagaataaaaga
atcattgaagagattaattttgatctattattagatctgattaaaaaacaaaaaattgag
aaggtaattattgcgactaattttactcaagatgggcaaacaacagcaaattacttacgc
tttttattagatgattttgatcttaaaatctatcgtttaggtatgggtttaccatacaat
tcttcaattgattatgctgattcctttagtttaaaaggcgcttttgaaaacaaacagcta
ataaaagataaaaaagcgtaa

DBGET integrated database retrieval system