KEGG   Mycoplasma gallisepticum R(high): MGAH_0644bHelp
Entry
MGAH_0644b        CDS       T01923                                 

Definition
glycerol kinase GlpK domain protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mgh  Mycoplasma gallisepticum R(high)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MGAH_0644b
Enzymes [BR:mgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MGAH_0644b
Exosome [BR:mgh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAH_0644b
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(15683..16738)
Genome map
AA seq 351 aa AA seqDB search
MDKKKYIITLDEGTTSCRSIVFDKQAKIVSVAQNEFTQYFPQSGWVEHDPLEIWNTQLST
MQSVKNKAQIKSVNVEAVGITNQRETVVLWNKETGLPVYNAIVWQDRRTSEYCETLTKHV
DKVREKTGLIINPYFSGTKIRWILKNVPLAQKTLKAGKLLAGTIDSWLIWKLTGGKVHAT
DVSNASRTLLFNIHTMDWDQELLDLFEIPRSILPEVKSSSEVYGYVEPSLWSQRATAKVP
ITGVAGDQQSALFGQLCLKPGMVKNTYGTGCFTLMNIGEKPIMSKNKLLTTVAWKLGKKK
PVYALEGSVFIAGAAVQWIRDGLRLIYDAAESDFYANLASKQDTHQVYLVP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagaaatacattattacattagacgaaggaactacatcttgtcgttcaatc
gtttttgataaacaagctaagatcgtaagtgttgcacaaaacgaatttacgcaatacttt
ccacaaagtggatgagttgagcatgatccattagaaatttggaatacccaactatctaca
atgcaatcggttaaaaacaaagctcaaattaaatcagtaaacgttgaggctgttggtatt
actaatcaacgtgaaactgttgttttatgaaataaagaaacggggcttccggtttataat
gcaattgtatgacaagaccgtagaacaagtgaatattgcgaaaccctaactaaacacgtt
gataaagttagagaaaaaactggtttaatcattaatccttatttctcaggtactaagatt
cgttgaatcttaaaaaatgttcctttagcgcaaaaaactttaaaagctggcaagttacta
gcaggaacaattgattcatgattaatttgaaaactaactggtggtaaggtacacgcaact
gatgtctcaaacgcatcaagaacattattatttaatattcacaccatggattgggatcaa
gaattattagatttatttgaaatccctcggtcgattcttccagaagttaaatcttcttct
gaagtttatggttatgtagaacctagtttgtgatctcaacgagctactgctaaagttccg
attacaggtgttgctggtgaccaacaatctgctttatttggtcagttgtgtcttaaacct
ggaatggttaaaaacacctatggaacaggttgcttcaccttaatgaacattggtgaaaaa
ccaattatgtctaagaacaaactgttaacaacagttgcttggaaactaggtaagaaaaaa
ccagtttatgcccttgaaggttctgtgtttattgctggagctgctgtccaatgaatacgt
gacggactaagattaatttatgatgcagctgaatctgatttttatgctaatttagcttct
aaacaagatactcaccaagtttatttagttccttaa

DBGET integrated database retrieval system