KEGG   Mycobacterium gilvum PYR-GCK: Mflv_0084Help
Entry
Mflv_0084         CDS       T00498                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mflv_0084
   01230 Biosynthesis of amino acids
    Mflv_0084
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_0084
  Energy metabolism
   00680 Methane metabolism
    Mflv_0084
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mflv_0084
Enzymes [BR:mgi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mflv_0084
Exosome [BR:mgi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mflv_0084
  Exosomal proteins of melanoma cells
   Mflv_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(74514..75266)
Genome map
AA seq 250 aa AA seqDB search
MADTATLILLRHGESEWNALNLFTGWVDVDLTDKGRAEATRAGELIGEQDKLPDVLYTSL
LRRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAETKAKYGDEQFMAWRRSY
DTPPPQIEAGSEFSQDRDPRYADIDGGAPLTECLKDVVERFVPYFTEVIVPDLKAGKTVL
IAAHGNSLRALVKYLDGMSDDDVVGLNIPTGIPLRYDLDESLKPLVAGGSYLDPDAAAAG
AAAVAAQGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgataccgcgacgctgatcctgctccgccacggtgagagcgaatggaacgccctg
aacctgttcaccggctgggtcgacgtcgacctcacggacaagggcagggccgaggcgacc
cgggcgggcgagttgatcggcgaacaggacaagcttcccgacgtgctgtacacctcgctg
ctgcggcgcgcgatcacgaccgcgaacatcgcgctcgacaaggccgaccggcactggatc
cccgtgcaccgcgactggcggctcaacgaacgccactacggcgcgctgcagggactgaac
aaggccgagacgaaggccaagtacggcgacgagcagttcatggcgtggcgtcgcagctac
gacaccccgcccccgcagatcgaggcaggcagcgagttcagccaggaccgcgacccgcgc
tacgccgacatcgacggtggcgctccgctgaccgaatgcctcaaggacgtcgtggaacgg
ttcgtgccgtacttcaccgaggtgatcgttcccgacctgaaagccgggaagaccgtgctg
atcgccgctcacggcaattcgctgcgcgcgctggtcaagtacctcgacgggatgtccgac
gacgacgtcgtgggcctcaacatcccgacgggcattccgctgcgctacgacctggacgag
agtctgaagcccctcgtggccggtggcagctacctcgaccccgatgccgcggccgccggt
gcggccgcggtggccgcgcagggagccaagtag

DBGET integrated database retrieval system