KEGG   Mycobacterium gilvum PYR-GCK: Mflv_0107Help
Entry
Mflv_0107         CDS       T00498                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00630  Glyoxylate and dicarboxylate metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01200  Carbon metabolism
Module
mgi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mflv_0107
Enzymes [BR:mgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mflv_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABP42602
JGI: Mflv0107
UniProt: A4T2Z9
Position
complement(95705..96991)
Genome map
AA seq 428 aa AA seqDB search
MSTVGMPKSPEQIQHDWDHNPRWKGITRTYTPADVVALQGHVVEEHTLARRGAEVLWEQL
HDMDFVNSLGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
IRRINNALLRADEIAKVEGDTSVENWLAPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVAGVPTVVIARTDAEAATLITSD
VDERDQPFITGDRTAEGFYRVKNGLEPCIARAKAYAPYSDLIWMETGTPDLELAKKFAEG
VKSEFPDQMLAYNCSPSFNWKQHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALAG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttggcatgccgaagagcccggaacagatccagcacgactgggaccacaac
ccccgctggaagggcatcacccgcacctacaccccggccgatgtcgtcgccctgcagggc
cacgtcgtcgaggagcacaccctggcccgccgcggcgccgaggtgctgtgggagcagctg
cacgacatggacttcgtcaactccctcggtgccctgaccggcaacatggccgtccagcag
gtccgcgccggcctgaaggccatctacctgtcgggttggcaggtcgccggcgacgcgaac
ctctccggccacacctacccggatcagagcctctacccggccaactcggtgccccaggtc
atccgtcgcatcaacaacgcgctgctgcgcgccgatgagatcgccaaggtggagggtgac
acctccgtcgagaactggctggccccgatcgtcgccgacggcgaggccggtttcggtggc
gcgctgaacgtctacgagctgcagaaggcgatgatcgccgccggtgtcgccggctcgcac
tgggaggaccagctggcctcggagaagaagtgcggccacctcggtggcaaggtgctgatc
ccgacccagcagcacatccgcaccctgacctcggcccgcctggccgccgacgtcgccggc
gtgccgaccgtcgtcatcgcccgcaccgacgccgaggccgccacgctcatcacctccgac
gtcgacgagcgcgatcagccgttcatcaccggtgaccgcaccgccgagggcttctaccgc
gtgaagaacggcctcgagccctgcatcgcgcgcgccaaggcgtacgcgccgtactccgat
ctgatctggatggagaccggcaccccggatctggagctggcgaagaagttcgccgagggc
gtcaagagcgagttcccggaccagatgctggcctataactgctcgccgtcgttcaactgg
aagcagcatctcgacgacgcgacgatcgcgaagttccagaaggagctcggcgcgatgggc
ttcaagttccagttcatcaccctcgccggcttccacgccctgaactactcgatgttcgat
ctggcctacggttacgcccgcaaccagatgagcgcctacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgcggctacaccgcgaccaagcaccagcgtgaggtcggcgccggc
tacttcgaccggatcgccaccaccgtggatccgaccagctcgaccaccgcgctcgcgggc
tcgaccgaagagggccagttccactga

DBGET integrated database retrieval system