KEGG   Mycobacterium gilvum PYR-GCK: Mflv_0107Help
Entry
Mflv_0107         CDS       T00498                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mgi01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mgi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(95705..96991)
Genome map
AA seq 428 aa AA seqDB search
MSTVGMPKSPEQIQHDWDHNPRWKGITRTYTPADVVALQGHVVEEHTLARRGAEVLWEQL
HDMDFVNSLGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
IRRINNALLRADEIAKVEGDTSVENWLAPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVAGVPTVVIARTDAEAATLITSD
VDERDQPFITGDRTAEGFYRVKNGLEPCIARAKAYAPYSDLIWMETGTPDLELAKKFAEG
VKSEFPDQMLAYNCSPSFNWKQHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALAG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttggcatgccgaagagcccggaacagatccagcacgactgggaccacaac
ccccgctggaagggcatcacccgcacctacaccccggccgatgtcgtcgccctgcagggc
cacgtcgtcgaggagcacaccctggcccgccgcggcgccgaggtgctgtgggagcagctg
cacgacatggacttcgtcaactccctcggtgccctgaccggcaacatggccgtccagcag
gtccgcgccggcctgaaggccatctacctgtcgggttggcaggtcgccggcgacgcgaac
ctctccggccacacctacccggatcagagcctctacccggccaactcggtgccccaggtc
atccgtcgcatcaacaacgcgctgctgcgcgccgatgagatcgccaaggtggagggtgac
acctccgtcgagaactggctggccccgatcgtcgccgacggcgaggccggtttcggtggc
gcgctgaacgtctacgagctgcagaaggcgatgatcgccgccggtgtcgccggctcgcac
tgggaggaccagctggcctcggagaagaagtgcggccacctcggtggcaaggtgctgatc
ccgacccagcagcacatccgcaccctgacctcggcccgcctggccgccgacgtcgccggc
gtgccgaccgtcgtcatcgcccgcaccgacgccgaggccgccacgctcatcacctccgac
gtcgacgagcgcgatcagccgttcatcaccggtgaccgcaccgccgagggcttctaccgc
gtgaagaacggcctcgagccctgcatcgcgcgcgccaaggcgtacgcgccgtactccgat
ctgatctggatggagaccggcaccccggatctggagctggcgaagaagttcgccgagggc
gtcaagagcgagttcccggaccagatgctggcctataactgctcgccgtcgttcaactgg
aagcagcatctcgacgacgcgacgatcgcgaagttccagaaggagctcggcgcgatgggc
ttcaagttccagttcatcaccctcgccggcttccacgccctgaactactcgatgttcgat
ctggcctacggttacgcccgcaaccagatgagcgcctacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgcggctacaccgcgaccaagcaccagcgtgaggtcggcgccggc
tacttcgaccggatcgccaccaccgtggatccgaccagctcgaccaccgcgctcgcgggc
tcgaccgaagagggccagttccactga

DBGET integrated database retrieval system