KEGG   Mycobacterium gilvum PYR-GCK: Mflv_0380Help
Entry
Mflv_0380         CDS       T00498                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mflv_0380
Enzymes [BR:mgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mflv_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
380523..381665
Genome map
AA seq 380 aa AA seqDB search
MTDPDWAPLTGFRVAVTSARRADELAALLRRRGATVTSAAAIEMVPLPDDDELRQRTQSL
IDAPPDIVIATTGIGFRGWVAAADGWGMAADLTTALSTARIVSRGPKATGALRAAGLPEE
WSPESESSRELLHYLVEGGIAGTRIAVQLHGATAEWDPFPEFLDELRAAGAEVVPIRVYR
WHPAPRNGDFDQLVAGIAEEKFDAVSFTSAPAVASVLLRATEMGLEAEVLSALRNGVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQARTVRVAGHLLEIRGTCVLV
DGTVKALSPAAMATIRALALKPGAVVSRTDLLRALPGSGTDTHAVETAVLRLRAALGDKK
MVSTVVKRGYRLPVDEAFAS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgactgatccggactgggcgccgctcaccggattccgcgtcgccgtcacctccgcgcgg
cgcgccgacgagctggccgcgctgctgcggcgccgcggcgcgacggtgaccagcgccgcc
gcgatcgagatggtgccccttcccgacgacgacgaattgcgtcaacgcacgcagtcgctc
atcgacgcaccccccgacatcgtgatcgcgacgaccgggatcgggttccgcggctgggtg
gccgcagccgacgggtggggcatggccgccgatctgacgacggcgctgagcacggcccgc
atcgtgtcgcggggcccgaaagccaccggtgcactgcgcgccgccggcctgcccgaggaa
tggtcgccggaatccgagtcgtcccgcgagctgctgcactacctggtcgagggcggtatc
gccggaacccgaatcgcggtgcagctgcacggagcgaccgcggaatgggatccgttcccc
gagttcctcgacgaattacgtgctgccggagcagaagtggtcccgatccgggtgtaccgc
tggcatccggccccccgcaacggggacttcgaccagttggtcgccgggatcgccgaggag
aagttcgacgcggtcagcttcacctcggcccccgcggtcgcgtcggtgctcctgcgcgcg
accgagatgggcctggaggccgaggtgctgtcggcgctgcgcaacggcgtgcacgcgatg
tgcgtcgggcccgtcaccgcacggccgctcgtgcggctcggggtgccgacatcggcgccg
gagaggatgcggttgggcgcgctggcccggcacatcaccgacgagctcccgctgctgcag
gcgcggacggtgcgggtcgccgggcacctgctggagatccgcggcacctgcgtgctggtc
gacggcacggtcaaggcgctgtcgccggccgcgatggcgacgatccgggcgctggcgctc
aagcccggcgcggtggtgtcacgcaccgacctgctgcgcgccctgccgggcagtggcacc
gacacccacgccgtcgagaccgcggtgcttcggctacgcgccgcgctgggggacaagaag
atggtgtcgactgtggtcaagcgcggctaccggctgcccgtcgacgaggcgttcgcgtca
tga

DBGET integrated database retrieval system