KEGG   Mycobacterium gilvum PYR-GCK: Mflv_0996Help
Entry
Mflv_0996         CDS       T00498                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00500  Starch and sucrose metabolism
mgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mflv_0996
Enzymes [BR:mgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mflv_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABP43479
JGI: Mflv0996
UniProt: A4T4B9
Position
complement(1041174..1043156)
Genome map
AA seq 660 aa AA seqDB search
MPPHRAVSEDLHRVAAAHGVATAYRNERREPVDVDADVVIKVLGLLDVDAATEDACRAEL
ARLAELDRAGVLAPTVATRLDGRPQPLPGAALLVAEDGERIDVRDELPGDLKPGWYRVHT
RDGQEATLVAAPPRVPPSPVTWGWMLQLYALRSAHSWGIGDLGDLRAFVDWTATRHGAGA
VLLNPLHAPGPTHPVQPSPYTPSSRRFANPLALRIEDIDAYRRADPDTRAEIDALRVSAT
TPRIDHDLVWAAKRGALELLWRADGRPDPLDGPSASGGLRDWATYCALAERHGGRWSRWP
EGLRDVAGPDVANARRELAPRLAFHAWVQQQCAEQLGAVRAAARDAGMPLGILHDLAVGV
DADGADAWALSDVLASGVSVGAPPDNFTPRGQDWGLPPWRPDRLADTGYAALRDMLRAVL
SHADGLRIDHVAGLWRLWWIPPGDGPDKGTYVHYDADTMLAVLALEAHRAGATVVGEDLG
TVEPEVTEALADNEMLGCAVAWFTRDQSAPGEPLLPPQRWPSRAAATLSTHDLPTAAGFL
RGEHVRVRAELELLDDVPAEKATADRERAEWLALLRSEGLLPDDGSEADEQDIIVAMHRL
LAATPSRLKLISPYDVIGDVRQPNLPGTVDEYPNWRLPLPLTLEELQADPRVAAITAAFR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
gtgcccccacaccgcgctgtctccgaggatttacaccgggtggccgccgcccacggcgtc
gccacggcgtaccggaacgaacggcgtgaacccgtcgacgtcgacgccgacgtggtaatc
aaagttctcggtctgctcgacgtcgacgccgccaccgaggacgcctgccgagcagagctc
gcccggctggccgaactcgaccgtgccggagtcctcgcgcccaccgtcgccacgcggctc
gacggccggccccagccactgccgggtgcagcgctgctggtggccgaggacggcgagcgg
atcgacgtccgcgacgagctgcccggtgatctgaagccgggctggtaccgagtgcacacc
cgcgacggtcaggaagcgacgctggtcgccgcgcctccccgggttcccccgtccccggtg
acgtggggctggatgctgcagctctacgcgctgcgctcggcccactcgtggggaatcggc
gacctcggcgatctgcgggcgttcgtggactggacggccacccggcacggagccggggcg
gtactgctcaacccgctgcacgcacccggcccgacgcatccggtgcagccctctccgtac
acgccgtcgagtcggcggttcgccaatccgttggcgctgcgcatcgaggacatcgacgcc
taccgtcgcgccgaccccgacaccagagccgagatcgacgcgctgcgcgtgtcggcgacg
accccgcgcatcgaccatgatctggtgtgggcggccaaacgcggtgcactggaactgctc
tggcgcgccgacggcaggccggacccgttggacggtccgtcggcttcgggcgggctgcgg
gattgggccacctactgtgcgctggccgagcggcatggcggccggtggtcgcgctggcca
gagggccttcgtgacgtcgcaggtcccgatgtggccaatgctcgccgggaattggctccg
cgcttggcatttcatgcatgggtgcagcagcagtgcgccgaacagctgggtgcggtccgc
gccgccgcacgcgatgccgggatgccgctcggcatcctgcacgatcttgcggtcggcgtg
gatgccgacggcgccgacgcgtgggcgctgtccgacgtgctcgcctccggtgtcagcgtc
ggcgccccgcccgacaacttcaccccgcgcggacaggactgggggctgccgccgtggcgg
ccggaccggttggccgacaccggatatgccgcgctgcgggacatgctgcgggcggtgctc
tcccatgccgacgggttgcgcatcgaccacgtcgcgggtctgtggcgcctgtggtggatc
ccgccgggcgacggacccgacaagggcacctacgtccactacgacgctgacaccatgctc
gccgtgctggcgctcgaagcccaccgcgccggggccaccgtggtcggtgaggatctgggc
accgtcgaaccggaggtcaccgaggcgctggccgacaacgagatgctgggttgcgcggtc
gcctggttcacgcgcgaccagtcggccccgggggagccgctgctgccgccgcagcgctgg
ccgtcgcgggccgcggcgaccctgtccacccatgatctgccgacagcggcgggtttcctt
cgcggagaacacgtccgggtccgcgccgagctggaactgctcgacgatgtgccggccgag
aaagccactgcggaccgggaacgcgccgaatggctcgcgctgctgcgctcggaggggctg
ctgcccgacgacggctccgaagccgacgagcaggacatcatcgtggcgatgcaccggttg
ctcgccgcgacgccgagccgcctgaaattgatctcgccgtatgacgtcatcggcgacgtc
cggcagccgaatctgcctgggacagtggacgaatacccgaactggcggctgccgttgcca
ctgaccctggaggaactgcaggccgatcccagggtcgcagcgatcaccgctgcgtttcgc
tga

DBGET integrated database retrieval system