KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1108Help
Entry
Mflv_1108         CDS       T00498                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Brite
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Mflv_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 NmrA Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ABP43590
JGI: Mflv1108
UniProt: A4T408
Position
1152874..1153905
Genome map
AA seq 343 aa AA seqDB search
MSAPVLVIGANGYLGSHVTRKLVAAGNDVRVMVRDGANTVGIDDLAVTRYVGDIWNTDVL
REAMTGCEVVYYCVVDTRGWLRDPAPLFRTNVEGTRNVLDVAVEPGIAATLRKFVFTSSC
VTVGRTRGRVATEADVISDPADLKSLTPYVRSRVQAENLVMEYARERGLPAVAMCVSTTY
GAGDWGRTPHGAIIAGAAFGKLPFVMGGIELEAVGIDDAAQAMLLAARKGRAGERYLISE
KMISNADVVRIAAEAAGVPAPTKKIPLVLSYAMAALGSAKSRLKGTDERMSLGSLRLMRA
EAPVDCSKARRELGWQPRPVEESIREAAKFWVGLKAAKRQRTA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgccggtcctcgtcatcggggccaacggctacctcggcagccacgtcacccgg
aaactcgtggccgccggcaacgacgtccgggtgatggtgcgcgacggcgccaacaccgtc
ggcatcgacgacctggcggtcacccgctacgtcggcgacatctggaacaccgacgtgttg
cgcgaggccatgacgggctgcgaggtcgtctactactgcgtcgtggacacccgcggctgg
cttcgcgacccggcgccgctgttccgcaccaacgtcgagggcacccgcaacgtcctggac
gtcgcggtggagcccgggatcgccgcgacgctgcggaagttcgtcttcaccagcagctgt
gtgaccgtggggcgcacgaggggacgtgtcgccaccgaggccgacgtgatctccgaccct
gccgatctgaagagcctgaccccctatgtccgttcgcgtgtccaggccgagaacctggtg
atggagtacgcgcgcgaacgcgggctgcccgcggtcgcgatgtgcgtgtccaccacgtac
ggcgccggtgactggggccgcaccccgcacggcgcgatcatcgcaggcgccgcgttcggc
aagctgccgttcgtgatgggcggcatcgaactcgaagcggtcgggatcgacgacgcggcg
caggccatgctgctggccgcgcggaagggtcgcgcgggtgagcggtacctgatctcggag
aagatgatctccaacgccgacgtcgtccggatcgccgccgaggccgccggagtgccggcg
ccgacgaagaagatcccgctggtgctgtcctatgcgatggcggcgctgggcagcgcgaag
tcccggctgaagggcaccgacgagcggatgtcgctgggatcgctgcggctgatgcgggcc
gaggctccggtcgactgcagcaaggcacgccgtgaactgggctggcagccccggcccgtg
gaggagtcgatccgcgaagccgcgaaattctgggtcggtctcaaagccgccaagcggcaa
cgcaccgcctga

DBGET integrated database retrieval system