KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1288Help
Entry
Mflv_1288         CDS       T00498                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mgi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1340948..1341559
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNRVRDGVTFCSVCG
NVSDEERCRICGDARRDASLICVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGIGPDQ
LRIRELLNRIGERVDGVDVAEVIIATDPNTEGEATATYLVRMLRDIPGLSVTRIASGLPM
GGDLEFADELTLGRALAGRRAMA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggacctgttcaggatctgatcgacgagctcggcaagctgccgggcatcggg
cccaagagtgcccagcgcatcgcgttccatctgttgtcggtcgaacctcccgacatcgac
cggctcaccgcggtgctcaaccgggtccgcgacggtgtcacgttctgctcggtgtgcggc
aacgtcagcgacgaggagcggtgccgaatctgcggggatgcgcgccgggacgcgtcgttg
atctgtgtggtcgaagaacccaaggacgtccaggccgtcgagcgcacgcgtgagttccgc
ggccgctaccacgtcctcggcggcgcactcgacccgttgtccgggatcggacccgaccag
ctgcgcatccgcgaactgctgaaccggatcggcgagcgcgtcgacggcgtcgacgtcgcc
gaggtcatcatcgccaccgaccccaacaccgagggcgaggccacggcgacgtacctggtg
cggatgctgcgcgacatcccggggctttccgtgacgcgcatcgcgtcgggcctgccgatg
ggcggagacctggagttcgccgacgagctcacgctggggcgggcgctggcgggccgccgc
gcgatggcgtaa

DBGET integrated database retrieval system