KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1380Help
Entry
Mflv_1380         CDS       T00498                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00010  Glycolysis / Gluconeogenesis
mgi00620  Pyruvate metabolism
mgi00640  Propanoate metabolism
mgi00680  Methane metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_1380
   00620 Pyruvate metabolism
    Mflv_1380
   00640 Propanoate metabolism
    Mflv_1380
  Energy metabolism
   00680 Methane metabolism
    Mflv_1380
Enzymes [BR:mgi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mflv_1380
Lipid biosynthesis proteins [BR:mgi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mflv_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABP43862
JGI: Mflv1380
UniProt: A4T5S9
Position
complement(1434417..1436378)
Genome map
AA seq 653 aa AA seqDB search
MTETHVDIPSSYPPDPGFAENANATEALYEQADADRLEFWAEQARRLAWETPFDEVLDWS
EAPFAKWFVGGTLNVAYNCVDRHVEAGNGDRVAIHWVGEPVEHSRDITYAELKDEVCRAA
NALTNLGLTAGDRVAIYMPMVPEAIIAMLACARLGAMHSVVFAGFSASALKARIEDAQAK
LVITTDGQYRRGSAVSLKTGVDEAIDGLGEDSPVEHVLVVRRTGIDTPWTPDRDLWWDET
VPEADTEHTPEAFDSEQPLFLLYTSGTTGKPKGIVHTSGGYLTQTAYTHHNVFDLKPESD
VYWCTADIGWVTGHSYIVYGPLANGATQVVYEGTPASPTEHRHFEIIEKYGVTIYYTAPT
LVRTFMRWGRQIPAEHDLSSLRLLGSVGEPINPEAWRWYRMAFGKDKTPIVDTWWQTETG
AIMISPLPGVTHCKPGSAMRALPGISAKVVDDDGNELERSPDHGEHATGYLVLDQPWPAM
LRGIWGDPERFKETYWSRFAEKGWYFAGDGARIGSDGEIWVLGRIDDVMNISGHRISTAE
VESALVGHSGVAEAAVVGATDEHTGQAICAFVILKSSAHGGEENMIDELRAEVAKEISPI
AKPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPSVFEAIRASK
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacgcacgtcgatattccgtcgtcctacccaccggatcccgggttcgccgag
aacgcgaacgcgaccgaggcactgtacgagcaggctgacgccgaccggcttgagttctgg
gccgagcaggcccgccgcctggcctgggagacgccgttcgacgaggttctggactggtcg
gaggcgccgttcgccaagtggttcgtcggcggcacgctcaatgtggcctacaactgcgtc
gaccgccacgtcgaggccggcaacggcgaccgggtcgcgatccactgggtcggtgagccg
gtcgagcactcccgcgacatcacctacgccgagctcaaggacgaggtgtgccgggccgcc
aacgcactcaccaacctgggcctgacggccggcgaccgcgtcgcgatctacatgccgatg
gtgcccgaggcgatcatcgcgatgctcgcgtgcgcacgtctgggcgccatgcacagcgtc
gtattcgccgggttctcggccagtgcgctcaaggcccgcatcgaggatgcccaggccaag
ctcgtcatcaccaccgacgggcagtaccggcgcgggtcggcggtctccctcaagaccggc
gtggacgaggccatcgacggactcggtgaggacagccccgtcgagcacgtgctggtggtg
cggcgtaccggcatcgacacaccgtggacgccggaccgcgacctgtggtgggacgagacc
gtgcccgaagcggacaccgagcacacgccggaggcgttcgactccgagcagccgctgttc
cttctctacacctcgggaacgaccggcaagcccaagggcatcgtgcacacctcgggcggc
tacctgacccagaccgcctacacccaccacaacgtcttcgacctcaagccggagtcggac
gtctactggtgcaccgccgacatcggctgggtcaccgggcacagctacatcgtctacgga
ccgctggccaacggcgccacgcaggtggtctacgagggcacgccggcctcccccaccgag
caccgccatttcgagatcatcgagaagtacggggtgacgatctactacaccgcgccgacg
ctggtgcgcacgttcatgcggtggggacgccagatccccgccgagcacgatctgtccagc
ctgcggctgctgggttcggtcggcgagcccatcaacccggaggcgtggcgctggtaccgg
atggcgttcggcaaggacaagaccccgatcgtcgacacctggtggcagaccgagaccggc
gcgatcatgatctcgccgctgccgggcgtgacgcactgcaagcccggttcggcgatgcgc
gcgctgccggggatctcggccaaggtcgtcgacgacgacggcaacgaactggagcgttcc
cccgaccacggcgagcacgccaccggatacctggtcttggatcagccgtggccggcgatg
ctgcgcggcatctggggtgatccggagcggttcaaggagacctactggtcccggttcgcc
gagaagggctggtacttcgccggcgacggcgcccgcatcggcagcgacggcgagatctgg
gtgctgggccgcatcgatgacgtcatgaacatctcggggcaccgcatctccaccgcggag
gtggaatcggcgctggtcgggcattcgggggtggccgaggccgccgtcgtcggggccacc
gacgagcacaccggtcaggcgatctgcgcgttcgtgatcctgaagtccagtgcgcacggc
ggcgaggagaacatgatcgacgagctgcgcgccgaggtcgccaaggagatctccccgatc
gccaaaccgcgcgagatccacgtcgtgccggagctgccgaagacccgcagcggaaagatc
atgcgccgcctgctgcgcgacgtggccgagggtcgcgaactcggcgacacgtcgacgctg
gtcgacccgagcgtgttcgaggcgatccgggccagcaagtag

DBGET integrated database retrieval system