KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1472Help
Entry
Mflv_1472         CDS       T00498                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mgi00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mgi00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1532849..1533610
Genome map
AA seq 253 aa AA seqDB search
MSESGMSDLRGRTAVVTGGAGGIGAACAKALAERGVTVTVADIDEVGAKTVAEEIGGKAW
ALDLLDVAALESLQLETDILVNNAGVQNISEIAEFPPEKFRSMMALMVEAPFLLIRAALP
HMYRNEFGRVINISSIHGLRASPFKVAYVTAKHALEGLSKVTALEGGPHGVTSNCVNPGY
VRTPLVTKQIADQARTHGIPEDQVVSDILLKESAVKRLVGPEEVGSLVAWLASPAAGMVT
GASYTMDGGWSAR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccggtatgagcgacctccgtggccgcaccgcagtggtcaccggcggcgcc
ggtggcatcggggcggcgtgcgcgaaggccctcgccgaacgcggtgtcacggtcaccgtc
gccgacatcgacgaggtgggcgccaagacggtggccgaggagatcggcggaaaggcttgg
gcgctggaccttctcgacgtcgctgccctcgagagtctgcagttggagaccgacatcctg
gtcaacaacgccggagtccagaacatcagcgagatcgcggagttcccacccgagaagttc
cgctcgatgatggcgctgatggtcgaggcgccgtttctgctgatccgtgccgcactaccg
cacatgtaccgcaacgagttcggccgcgtcatcaacatctcgtcgatccacggcctgcgt
gcgtcgccgttcaaggtcgcctatgtgacggccaagcacgcgctggaagggctgtccaag
gtgacggcgctcgaaggcggaccgcacggcgtcacgagcaactgcgtcaaccccggatac
gtccgtaccccgctggtgaccaagcagatcgcggatcaggccaggacgcacggcatcccg
gaggaccaggtggtctccgacatcctgctcaaggagagcgcggtcaagcggctcgtcggg
ccggaggaggtcggctcactggtggcgtggctggcctcgcccgcggccgggatggtcacc
ggcgcgtcgtacaccatggacggcggatggagcgctcggtga

DBGET integrated database retrieval system