KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1619Help
Entry
Mflv_1619         CDS       T00498                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00480  Glutathione metabolism
mgi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mflv_1619
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mflv_1619
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mflv_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABP44101
JGI: Mflv1619
UniProt: A4T7K5
Position
1690823..1691317
Genome map
AA seq 164 aa AA seqDB search
MTSALTAIPLTTLDGRSTTLAELADGAALVVNVASKCGLTPQYTALEQLAKDYGPRGLTV
IGVPCNQFMGQEPGSAEEIQEFCSTTYGVTFPLLAKTDVNGADRHALYAELTKTADDAGE
AGDVQWNFEKFLLAPGGEVVKRFRPRTTPDDPAVIAAIDDVLGT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgcgctcaccgcaatcccgctcacgacgctcgacggccggtcgaccacgctg
gccgagttggccgacggcgccgcgctcgtcgtcaacgtcgcctccaagtgcggtctgaca
ccgcagtacaccgcactcgaacagctcgccaaggactacggcccgcgcgggctgacggtg
atcggggtgccgtgcaaccagttcatggggcaggagccgggcagcgccgaggagatccag
gagttctgctccaccacctacggcgtgacgttccccctgctggcgaaaaccgacgtcaac
ggcgccgaccgccatgcgctgtacgccgagctcaccaagaccgccgacgacgccggagag
gccggcgacgtgcagtggaacttcgaaaagttcctgctcgcccccggcggcgaggtcgtc
aagcggttccgaccccgcaccacccccgacgatcccgccgtgatcgcggcgatcgacgac
gtgctgggaacgtag

DBGET integrated database retrieval system