KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1877Help
Entry
Mflv_1877         CDS       T00498                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mgi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1953937..1955328
Genome map
AA seq 463 aa AA seqDB search
MTSPNDLPRTVGELRASGHRERTVKAEIRENLLAALASGAPVDEVWPGILGFEDTVLPQL
ERALIAGHDIVLLGERGQGKTRLLRGLTGMLDEWTPVIAGAELGEHPYSPITPESIRRAA
DFGDDLPIAWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRA
HRGIVAVNELPDLAERIQVAMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRI
ITPLKDRFGAEIRTHYPLELDAEVGVIVQEAHMAAEVPDYLLQILARFARALRESSSVDQ
RSGVSARFAIAAAETVAASARHRAAVLNEQEPVARVVDLASILDVLRGKLEFESGEEGRE
QAILEHLLRRATAETAQRLLGGIDVGPIVTAVEGGSPVTTGDRVSARDVLAALPEVSAVA
EIQQRLGAQTDGQRAAAIELALEALYLAKRIDKVSDQGETVYG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacctaacgacctcccccgcaccgtcggcgaactgcgcgcgtccggacaccgc
gaacgcaccgtcaaggccgagatccgggagaatctgctggcggcgctcgcgtcgggcgct
cccgtcgacgaggtgtggcccggcatcctgggcttcgaggacaccgtcctgccgcagctg
gagagggccctgatcgccgggcacgacatcgtgctgctcggcgagcgcgggcagggcaag
acccgcctgctgcgcgggctgaccgggatgctcgacgaatggacgccggtgatcgcgggc
gccgagctcggagaacacccgtacagcccgatcacgccggaatcgatccgccgggccgcg
gacttcggtgacgacctcccgatcgcgtggcggcaccgcagcgagcgctacaccgagaag
ctggccacccccgacacgagtgtggccgacctcgtcggtgacatcgacccgatcaaggtg
gccgagggccgcagcctcggtgaccccgagaccatcgcctacgggctcatcccgcgcgca
caccgcggcatcgtcgccgtcaacgagctcccggacctggccgaacgcatccaggtcgcg
atgctcaacgtgatggaggaacgcgacatccaggtgcgcggctacacgttgcgtctgccg
ctcgacgtgctcgtcgtcgccagcgccaaccccgaggactacacgaaccgggggcgcatc
atcaccccgctgaaggaccggttcggcgccgagatccgcacgcactacccgctggagctc
gacgccgaggtcggcgtcatcgtgcaggaggcgcacatggcggccgaggtgccggactat
ctgctgcagatcctggcccggttcgcccgcgcgctgcgcgaatccagttcggtcgaccag
cggtccggcgtctccgcccgcttcgcgatcgcggccgccgagaccgtcgccgcctcggcc
cggcaccgcgccgcggtactcaacgagcaggagccggtggcccgcgtggtcgacctggcg
tcgatcctcgacgtgctgcggggcaagctggagttcgagtccggtgaggaaggtcgcgag
caggcgatcctggagcatctgctgcgccgcgccacggccgagacggcgcagcggctcctc
ggcgggatcgacgtcggcccgatcgtcaccgcggtcgagggcggatcgcctgtcaccacc
ggcgaccgggtctcggcccgcgacgtgttggccgcgctgcccgaggtgtcggccgtcgcc
gagatccagcagcgcctcggcgctcagaccgacgggcagcgggccgcggcgatcgagctg
gccctcgaagcgctctatctggccaagcggatcgacaaggtgtccgaccagggcgagacg
gtctacggctga

DBGET integrated database retrieval system