KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1877Help
Entry
Mflv_1877         CDS       T00498                                 

Definition
(GenBank) putative magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00860  Porphyrin and chlorophyll metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mflv_1877
Enzymes [BR:mgi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mflv_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_3 AAA_PrkA MCM AAA_16 ABC_tran NACHT
Motif
Other DBs
NCBI-ProteinID: ABP44357
JGI: Mflv1877
UniProt: A4T6U7
Position
1953937..1955328
Genome map
AA seq 463 aa AA seqDB search
MTSPNDLPRTVGELRASGHRERTVKAEIRENLLAALASGAPVDEVWPGILGFEDTVLPQL
ERALIAGHDIVLLGERGQGKTRLLRGLTGMLDEWTPVIAGAELGEHPYSPITPESIRRAA
DFGDDLPIAWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRA
HRGIVAVNELPDLAERIQVAMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRI
ITPLKDRFGAEIRTHYPLELDAEVGVIVQEAHMAAEVPDYLLQILARFARALRESSSVDQ
RSGVSARFAIAAAETVAASARHRAAVLNEQEPVARVVDLASILDVLRGKLEFESGEEGRE
QAILEHLLRRATAETAQRLLGGIDVGPIVTAVEGGSPVTTGDRVSARDVLAALPEVSAVA
EIQQRLGAQTDGQRAAAIELALEALYLAKRIDKVSDQGETVYG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacctaacgacctcccccgcaccgtcggcgaactgcgcgcgtccggacaccgc
gaacgcaccgtcaaggccgagatccgggagaatctgctggcggcgctcgcgtcgggcgct
cccgtcgacgaggtgtggcccggcatcctgggcttcgaggacaccgtcctgccgcagctg
gagagggccctgatcgccgggcacgacatcgtgctgctcggcgagcgcgggcagggcaag
acccgcctgctgcgcgggctgaccgggatgctcgacgaatggacgccggtgatcgcgggc
gccgagctcggagaacacccgtacagcccgatcacgccggaatcgatccgccgggccgcg
gacttcggtgacgacctcccgatcgcgtggcggcaccgcagcgagcgctacaccgagaag
ctggccacccccgacacgagtgtggccgacctcgtcggtgacatcgacccgatcaaggtg
gccgagggccgcagcctcggtgaccccgagaccatcgcctacgggctcatcccgcgcgca
caccgcggcatcgtcgccgtcaacgagctcccggacctggccgaacgcatccaggtcgcg
atgctcaacgtgatggaggaacgcgacatccaggtgcgcggctacacgttgcgtctgccg
ctcgacgtgctcgtcgtcgccagcgccaaccccgaggactacacgaaccgggggcgcatc
atcaccccgctgaaggaccggttcggcgccgagatccgcacgcactacccgctggagctc
gacgccgaggtcggcgtcatcgtgcaggaggcgcacatggcggccgaggtgccggactat
ctgctgcagatcctggcccggttcgcccgcgcgctgcgcgaatccagttcggtcgaccag
cggtccggcgtctccgcccgcttcgcgatcgcggccgccgagaccgtcgccgcctcggcc
cggcaccgcgccgcggtactcaacgagcaggagccggtggcccgcgtggtcgacctggcg
tcgatcctcgacgtgctgcggggcaagctggagttcgagtccggtgaggaaggtcgcgag
caggcgatcctggagcatctgctgcgccgcgccacggccgagacggcgcagcggctcctc
ggcgggatcgacgtcggcccgatcgtcaccgcggtcgagggcggatcgcctgtcaccacc
ggcgaccgggtctcggcccgcgacgtgttggccgcgctgcccgaggtgtcggccgtcgcc
gagatccagcagcgcctcggcgctcagaccgacgggcagcgggccgcggcgatcgagctg
gccctcgaagcgctctatctggccaagcggatcgacaaggtgtccgaccagggcgagacg
gtctacggctga

DBGET integrated database retrieval system