KEGG   Mycobacterium gilvum PYR-GCK: Mflv_1934Help
Entry
Mflv_1934         CDS       T00498                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00900  Terpenoid backbone biosynthesis
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01130  Biosynthesis of antibiotics
Module
mgi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mflv_1934
Enzymes [BR:mgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mflv_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABP44414
JGI: Mflv1934
UniProt: A4T6N7
Position
2011681..2012649
Genome map
AA seq 322 aa AA seqDB search
MSARDGNTASEWVPTGSVTVRVPGKVNLYLDVGDRRQDGYHELTTVFHAVSLLDEVTVRT
ADTLSLEHVGEGADSLPTDERNLAWRAAELMAEHVGRAPDVAISIEKTIPVAGGMAGGSA
DAAAVLVAMNSLWELGVPRRDLHALAAQLGSDVPFALHGGTALGTGRGEELATVLTRNTF
HWVLAFSPGGLSTAKVFAEIDRLRAEEDRTLPPRLESPEPVLAALASGDPAQLAPLLGND
LQPAALSLDPALRRTLRAGLDAGALAGLVSGSGPTCAFLCTSAGAAVDIGTDLAGAGVCR
TVRVASGPVQGARVVPAPSTAG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcgcgcgacggtaatacggcatcggagtgggttcccacgggttcggtcaccgtc
cgcgtgcccggcaaggtcaatctctatctcgacgtcggtgaccgtcggcaggacggctac
cacgagctgacgaccgtcttccacgccgtatcgctgctcgacgaggtcacggtgcggacc
gccgacacgctgtcgctggagcacgtcggagagggcgccgactcgctccccaccgacgag
cgcaatctcgcctggcgcgccgcggaactgatggccgagcatgtcggccgcgcgcccgat
gtcgcgatctcgatcgagaagaccatcccggtggccggcgggatggcgggcggcagcgcc
gatgcggcggccgtactggtcgcgatgaattcgctctgggagctcggggtgccgcggcgc
gatctgcatgcgctcgccgcccagttgggtagcgacgtgccgttcgcgctgcacggcggt
acggcgctgggcaccggtcgcggcgaggaactcgcgacggtgctgacccgcaacacgttc
cattgggtgctcgcgttctcacccggtggcctgtcgaccgccaaggtcttcgccgagatc
gaccggctgcgcgccgaggaggaccgcacccttccaccccgtctggagtcgcccgagccc
gtgctggcggcgctggcgtccggtgatccggcgcagctggcgccgctgctcggcaacgat
ctgcagccggcggcgctgagccttgacccggcgctgcgccggactctgcgcgcgggtctc
gacgccggcgcgctggctggtctggtgtccggatccggccccacctgcgcgttcctgtgc
acgtcggccggcgccgccgtcgacatcgggaccgatctggcgggcgcgggggtgtgtcgc
accgtccgcgtggccagcggaccggtgcagggcgcgcgggtcgtaccggccccgtcgacc
gccggctga

DBGET integrated database retrieval system