KEGG   Mycobacterium gilvum PYR-GCK: Mflv_2036Help
Entry
Mflv_2036         CDS       T00498                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00071  Fatty acid degradation
mgi00280  Valine, leucine and isoleucine degradation
mgi00281  Geraniol degradation
mgi00310  Lysine degradation
mgi00360  Phenylalanine metabolism
mgi00362  Benzoate degradation
mgi00380  Tryptophan metabolism
mgi00410  beta-Alanine metabolism
mgi00627  Aminobenzoate degradation
mgi00640  Propanoate metabolism
mgi00650  Butanoate metabolism
mgi00903  Limonene and pinene degradation
mgi00930  Caprolactam degradation
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01212  Fatty acid metabolism
Module
mgi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mflv_2036
   00650 Butanoate metabolism
    Mflv_2036
  Lipid metabolism
   00071 Fatty acid degradation
    Mflv_2036
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mflv_2036
   00310 Lysine degradation
    Mflv_2036
   00360 Phenylalanine metabolism
    Mflv_2036
   00380 Tryptophan metabolism
    Mflv_2036
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mflv_2036
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mflv_2036
   00281 Geraniol degradation
    Mflv_2036
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mflv_2036
   00627 Aminobenzoate degradation
    Mflv_2036
   00930 Caprolactam degradation
    Mflv_2036
Enzymes [BR:mgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mflv_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 CobA_CobO_BtuR
Motif
Other DBs
NCBI-ProteinID: ABP44514
JGI: Mflv2036
UniProt: A4T9D2
Position
complement(2113849..2114622)
Genome map
AA seq 257 aa AA seqDB search
MTFETILVDRDDRVATITLNRPKALNALNTQVMNEVTTAAAELDAEPGVGAIIVTGSERA
FAAGADIKEMASLSFADVFSSDFFAAWGKFAATRTPTIAAVAGYALGGGCELAMMCDILI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRNMDAEEAERAGLVSRVV
PADSLLSEAKAVAQTIAGMSLSASRMAKEAVDRAFETTLSEGLLYERRLFHSAFATDDQT
EGMNAFSEKRSPNFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgagaccatcctggtcgaccgcgacgaccgcgtcgcgacgatcacgctgaac
cggccgaaggcgctcaacgcgctcaacacccaggtgatgaacgaagtcaccacggccgca
gccgagctcgatgccgagcccggcgtcggcgccatcatcgtcaccggaagcgagagggcg
ttcgcggcaggggccgacatcaaggagatggcctcgctgtcgttcgccgatgtcttctcc
tccgacttcttcgccgcgtggggcaaattcgccgccacccgcaccccgacgatcgccgcg
gtggccggttacgcgctgggcggcggctgcgagctcgcgatgatgtgcgacatcctgatc
gccgccgacaccgcgaagttcgggcagcccgagatcaagctcggcgtgctgcccggcatg
ggcggatcgcaacggctgacgcgcgcgatcggcaaggccaaggcgatggacctgatcctg
accggccgcaacatggacgccgaggaggccgagcgcgcgggcctggtctcacgcgtcgtt
ccggcggactcgctgctgtcggaggccaaggccgtcgcacagacgatcgcggggatgtcg
ctgtcggcatcgcggatggccaaggaggccgtcgaccgggcattcgagacgacactgtcc
gaaggcctgctgtatgagcgccggttgttccactcggcgttcgccaccgacgaccagacc
gaggggatgaacgcgttcagcgagaaacgttcgccgaacttcacccatcgctag

DBGET integrated database retrieval system