KEGG   Mycobacterium gilvum PYR-GCK: Mflv_2094Help
Entry
Mflv_2094         CDS       T00498                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mgi00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2169878..2170252)
Genome map
AA seq 124 aa AA seqDB search
MTRSPDDVVTEFCAKWATPDPAELSAYFTEDGVYHNIPMERVVGRAAIADFIADFTAAVD
GIDFQVHHQVGAGNLVFNERTDVMRFKDGRELALPVTGVFEVVDGQIAAWRDYFDMSTVA
AAWA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacacgctcccccgatgacgtggtgacggagttctgcgcgaagtgggcgacgcccgac
cccgccgaactcagcgcgtacttcaccgaagacggtgtctaccacaatattccgatggaa
cgggtggtcggcagggccgccatcgcggatttcatcgccgacttcaccgcggcggtcgac
gggatcgatttccaggtgcaccaccaggtcggtgcgggaaacctcgtcttcaacgagcgc
accgacgtgatgcggttcaaggacggtcgcgagctcgcgctgccggtgacaggggtgttc
gaggtcgtcgacggtcagatcgccgcgtggcgtgactatttcgacatgtccaccgtcgcc
gccgcctgggcctag

DBGET integrated database retrieval system