KEGG   Mycobacterium gilvum PYR-GCK: Mflv_2273Help
Entry
Mflv_2273         CDS       T00498                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mgi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2363823..2364569
Genome map
AA seq 248 aa AA seqDB search
MTDDHELAGRLATAAGALLLDVRAELAEATPEERKAAGDKRAHDFLLAALTAERPEDAVL
SEEGVDDPVRLSAQRVWIVDPLDGTREFSELGRTDWAVHVALWERTGSGGELVAGAVALP
AQGVTLVTPTVVAPPAGPSSPRVVVSRTRPPAVALDVKDALNGTLVEMGSAGAKVASVVQ
GLSDVYVHAGGQYEWDSAAPVAVARAAGLHTSRIDGSPLVYNQRDSKLPDLIVCRPELAD
AVLAVTTR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacgaccacgagcttgcgggccggctggccaccgcggccggcgcgttgctgctc
gacgtccgtgccgagctcgccgaggcgacgcccgaggagcggaaagcggccggggacaag
agggctcacgatttcctgctggctgcgctgaccgccgaacgtcctgaggatgcggtcctg
tcggaggaaggcgtggacgacccggtgcggctgtccgcgcagcgggtgtggatcgtcgac
ccgctggacggcacccgcgagttctccgagctcgggcgcacggactgggctgtgcacgtc
gcgctgtgggagcgcaccggaagcggcggcgagctcgtcgccggggcggtggcacttccc
gcccagggtgtcacgctggtgaccccgacggtggtggcgccgcccgccggtccgtcgtct
ccgcgcgtcgtggtgtcacgcacccggccgccggccgtcgcgctggacgtcaaggatgcg
ctgaacggcactctggtcgaaatgggttcggcgggagccaaagtcgcgtctgtcgtgcag
ggactgtccgacgtctacgtgcatgccggcggtcagtacgagtgggactcggcggcgccg
gtcgccgtcgcccgggccgcgggtctgcacacctcccgcatcgacggctcgccgttggtc
tacaaccagcgcgactccaagctgcccgacctcatcgtgtgccggcccgaattggccgac
gcggtgctggccgtcaccacgcgctga

DBGET integrated database retrieval system