KEGG   Mycobacterium gilvum PYR-GCK: Mflv_2331Help
Entry
Mflv_2331         CDS       T00498                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mflv_2331
   00330 Arginine and proline metabolism
    Mflv_2331
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mflv_2331
Enzymes [BR:mgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Mflv_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2428677..2429954
Genome map
AA seq 425 aa AA seqDB search
MAELVQRRLDRIRAEHAEVADGELADYIPELAGVDPDGFGLSLSTSDGFIYESGQAATEF
TIQSISKPLTYALALHLIGLDAVDARIGVEPSGEAFNEISVDRVTNNPKNPMINAGAITA
VSLIPAGSPDERFALIHDFYSACVGRRLELDHDVYTSEKASGARNRAIGYMLQSFGALDD
DPDEVLDVYYRQCSLRVTCTDLARMGATLARGGMNPVTGRRVTSAAVVRRTLSVMVTCGM
YDGAGDWVSAVGMPAKSGVGGGIVAVLPGQLGIGVYSPRLDDKGNSVRGVLTCRSLSEQL
GLHFLTVRRDARATLRAVYEPRPGVRVYEAHGDLLFSGAEEVLRVAERERDRYDVTILDV
SRVDDIDDTAREMLSALGAALRADGKEGHLVDPDGVVARAGSPEIRFRTVDDVLDALDRR
RRPTP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactggtgcagcggcgcctggaccgtatccgggccgaacacgcagaggtcgcc
gacggcgagctggccgattacattcccgagctcgcgggcgtcgacccggacggcttcggc
ctgtcgctgtccacctccgacggcttcatctacgaatccgggcaggcggcaacggaattc
accatccagtcgatctccaagccgctcacctacgcgctggccctccacctcatcggactc
gatgcggtcgacgccaggatcggtgtcgaaccctccggcgaggccttcaacgagatcagc
gtggaccgcgtcaccaacaacccgaagaacccgatgatcaacgccggggccatcacggcg
gtgtcgctgatcccggcgggctcacctgacgagcgattcgctttgatccacgatttctat
tccgcatgcgtcggacgccggctcgagctcgaccacgacgtgtacacgtcggaaaaggcg
tcaggggcccgcaatcgggcgatcgggtacatgctgcagagcttcggggccctcgacgac
gatcccgacgaggtgctcgacgtctactaccggcagtgctcgctgcgggtcacgtgcacc
gacctggcccggatgggggccactctggcccgcggaggtatgaaccctgtgacgggtcgt
cgggtcacctcggcggcggtggtccggcgcacgttgtcggtgatggtcacctgcggcatg
tacgacggcgccggtgactgggtcagcgctgtgggcatgcccgccaagagcggggtcggc
ggcggcatcgtcgcggtcctgccgggtcagctcgggatcggcgtgtactcgcctcgcctc
gacgacaagggcaacagcgtccggggtgtgctgacctgccgcagcctctccgagcaactc
gggctgcacttcctgaccgtgcgtcgcgatgcgcgggccaccctacgggccgtctacgaa
ccgcgtcccggtgtgcgggtgtacgaagcgcacggtgacctgctcttcagtggcgccgaa
gaggtgctgcgggtcgccgaacgcgaacgcgaccgctatgacgtcaccatcctggacgtc
tcccgggtcgacgacatcgacgacacggcacgcgagatgctctcggcgctgggggccgca
ctgcgggccgacggcaaggaggggcacctcgtcgatcccgacggagtggtggcgcgtgcc
ggatcgccggagatccggttccggacagtcgacgacgtgctcgacgccctggaccggcgg
cggcgcccgaccccgtga

DBGET integrated database retrieval system