KEGG   Mycobacterium gilvum PYR-GCK: Mflv_2375Help
Entry
Mflv_2375         CDS       T00498                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Brite
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Mflv_2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2472477..2473493
Genome map
AA seq 338 aa AA seqDB search
MAGTKLVIGASGFLGSHVTRQLVADGDADVRVLIRRTSSTRGIDGLPVEVRYGDIFDADA
LRTAMSGCDVVYYCVVDARPWLRDPRPMWRTNVDGLRTVLDIAADAGLTRFVFTSSIGTI
GLRAGGPADERTEHNWLDRGGEYIRSRVVAEEMVLRDSARNRLPGVAMCVANTYGPGDFQ
PTPHGAMLAAAVRGKLPFYIRGYEAEAVGIEDAARAMILAGERGRIGERYIVSDRFISTR
EIHEIGCAAVGMRPPRFGVPIRAMAAAAHLGAAVARVRNTDTMLTPLNIRLMHIMTPLDH
SKAVRELGWHPRPLADSIVSAAHFFTDRRRSAAPEGTR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaacgaagctggtgatcggtgccagcggtttcctcggctcccacgtcaccagg
caactggtcgccgacggcgacgcggacgtgcgggtgctgatccggcggaccagttcgacc
cgcgggatcgacggtctgcccgtcgaggtccgctacggcgacatcttcgacgccgacgca
ctgcgcaccgcgatgtcgggatgcgatgtcgtctactactgcgtggtcgacgcgaggccc
tggttgcgcgatccgcggccgatgtggcggacgaacgtcgacggtctgcgcacagtgctc
gacatcgccgccgacgccggtctcacccggttcgtcttcaccagttccatcgggaccatc
gggttgcgggccggtgggccggccgatgagcgcaccgaacacaactggctcgaccgcggc
ggggagtacatccggtccagggtcgtggccgaggagatggtgctgcgcgacagcgcccgg
aacaggctcccgggcgtggcgatgtgcgtggccaacacctacggacccggcgacttccag
ccgacaccacacggggcgatgctggccgccgcggtgcgcggcaagctgccgttctacatc
cggggctacgaggccgaggcggtcggcatcgaggatgccgcccgagcgatgatccttgcc
ggcgaacgcggccggatcggcgagcggtacatcgtgtcggaccggttcatcagcacccgg
gagatccatgagatcggttgcgcggcagtgggcatgaggccaccgaggttcggcgtgcct
attcgggcgatggcggccgccgcccatctgggcgcggctgtcgcacgggtgcggaacacg
gacaccatgctcaccccgctgaacatccgcctgatgcacatcatgacgccgctggaccat
tccaaggccgttcgcgagctcggttggcacccgcgaccgctcgcggactcgatcgtctcg
gccgcgcacttcttcaccgaccggagacgatccgccgcccccgagggaacccgatga

DBGET integrated database retrieval system