KEGG   Mycobacterium gilvum PYR-GCK: Mflv_2655Help
Entry
Mflv_2655         CDS       T00498                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Brite
Enzymes [BR:mgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     Mflv_2655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2781591..2782265
Genome map
AA seq 224 aa AA seqDB search
MTIRRLVMLRHGQTEYNAGSRMQGQLDTDLSDLGREQAASAADALAKRHPLLIVSSDLRR
ALDTAVVLGDRCGQPVSIDARLRETHLGDWQGMTHLEVDEVAPGARLAWRDDARWAPHGG
ESRIDVARRSLPLVRELVTQQTEWGSAGDRPVVLVAHGGLIAALTAALLGLPADNWPVLG
GMGNASWVQLAGHTRADGDPASFDDIRWRLDVWNASAQVAGDVL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatccggcggctggtcatgctccggcacggccagaccgagtacaacgcgggaagc
cgcatgcagggccaactcgacaccgatctcagcgatctgggccgagagcaggccgcatcc
gcggccgatgccctggccaaacgccacccgctgctgatcgtgtcctcggatctgcggcgc
gccctcgacaccgcggtcgtgctcggcgaccggtgcggacaaccggtcagcatcgacgcc
cggctgcgtgagacgcacctcggggactggcaggggatgacgcatctggaggtcgacgag
gtcgcgcccggcgcgcggctggcgtggcgcgacgacgcccgttgggccccgcacggcggc
gagagccgcatcgatgtcgcccggcggagcctgcctctggtgcgcgagctggtgacgcag
cagaccgagtggggatcggcgggggaccggccggtggtgctcgtcgcgcacggcgggctc
atcgccgcgctgacggcggcactgctcgggctgcccgccgacaactggccggtactgggc
ggcatgggtaacgcgagctgggtgcagctggccggccacacccgggccgacggcgatccg
gcatccttcgacgacatccggtggcgtctcgacgtgtggaacgcctcggcgcaggttgcc
ggcgatgtcctctga

DBGET integrated database retrieval system