KEGG   Mycobacterium gilvum PYR-GCK: Mflv_2935Help
Entry
Mflv_2935         CDS       T00498                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mflv_2935
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mflv_2935
  Amino acid metabolism
   00310 Lysine degradation
    Mflv_2935
Enzymes [BR:mgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mflv_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3103113..3104957)
Genome map
AA seq 614 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEEDEPLLEVSTDKVDTEIPSPASGVLKKIV
AQEDDTVEVGGELAVIGDADDSDSDDSDSDDAGDSDDSEAEDSGDEAEPAAEESEPEPEP
EPEDEDEPEPEPKKKSSGGSGSSGSGTSVTMPELGESVTEGTVTRWLKEVGDTVEVDEPL
VEVSTDKVDTEIPSPVAGTLLSITAEEDDTVEVGGELAKIGDAGAEEESEPEPEPEPEPE
PEPEPEPKQTKPESKPSEEAAPEPKSESKPEAESKPEPKPKPEPEPKRESKPEAESSGDS
PYVTPLVRKLAGEHGVDLASVKGTGVGGRIRKQDVLAAAEKSKAPKEDAPKAEPAAEAPG
KTTQAPAPEGALAHLRGTTQKANRIRQITAKKTRESLQTTAQLTQVHEVDMTRIVALRAK
AKAGFAEREGVNLTYLPFIARAVIDALKLHPNVNASYNEESKEITYHEAEHLGIAVDTEQ
GLLSPVIHNAGDLSLGGLARAISDIAGRARSGNLKPDELSGGTFTITNIGSQGALFDTPI
LVPPQAAMLGTGAIVKRPRIIIDEFGNESIGVRSVSYLPLTYDHRLIDGADAGRFVTTIK
RRLEEGAFEADLGL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctccgtccagatgcccgcactcggagagagcgttaccgaggggaccgtcacc
cgctggttgaagcaggagggagacacggtcgaggaggacgagccactgctcgaggtgtcg
accgacaaggtcgacaccgagatcccgtctccggcatcaggtgtgttgaagaagatcgtc
gcgcaggaggacgacaccgtcgaggtcggcggagagcttgccgtgatcggcgacgccgac
gacagtgactccgacgacagtgactccgacgatgccggcgacagtgacgacagcgaggcc
gaggacagcggcgacgaggccgaacctgccgccgaggaatccgagcccgagcccgagccg
gaacccgaagacgaagacgagcccgaacccgagcccaagaagaagtcctcgggcggatcc
gggtcctccggatcggggacgtcggtgacgatgcccgagctcggcgagtcggtcaccgaa
ggcaccgtgacgcggtggctgaaggaggtcggcgacaccgtcgaggtcgacgagccgctc
gtcgaggtgtccaccgacaaggtcgacaccgagatcccgtcgcccgtcgccggcactctg
ctgtcgatcacggccgaggaggacgacaccgtcgaggtcggcggagagctcgccaagatc
ggtgacgcgggcgccgaggaagaatccgagccggaaccggaaccggagcccgaacccgag
cctgaacccgagcccgagccgaagcagacgaagcccgagtccaagccctccgaggaggcg
gcacccgagcccaagtccgagtccaagcccgaagccgagtccaagcccgagcccaagccg
aagcccgaaccggagcccaagcgcgagtcgaagcccgaagccgagtcgtcgggcgacagc
ccctacgtgacgccgctggtgcgcaagctggccggtgagcacggcgtcgacctcgcgtcg
gtcaagggcaccggtgtcgggggacgcatccgcaagcaggacgtgctcgcggccgccgag
aagagcaaggcgcccaaggaggacgccccgaaggcggaaccggccgccgaggctccgggc
aagaccactcaggcaccggcgccggagggcgcgctggcccacctgcgcggcacgacccag
aaggccaaccggatccggcagatcacggccaagaagacccgggagtcgctgcagaccacg
gcacagctgacccaggtccacgaggtcgacatgaccaggatcgtcgcgctgcgggccaag
gccaaggcgggcttcgccgagcgcgagggcgtcaacctgacctacctgccgttcatcgcc
agggcggtcatcgacgcgttgaagctgcatccgaacgtcaacgccagctacaacgaggaa
tccaaggagatcacctaccacgaggccgagcacctgggcatcgccgtcgacaccgagcag
ggcctgctctccccggtgatccacaacgccggcgacctgtcgctgggcgggctggcgcgg
gccatctccgacatcgccgggcgtgcccgctcgggcaacctcaagcccgacgagctgtcc
ggcggcacgttcaccatcaccaacatcggcagccagggcgcgttgttcgacacaccgatc
ctggtcccgccgcaggcggcgatgctgggtaccggtgcgatcgtcaagcgcccccgcatc
atcatcgacgagttcggtaacgagtcgatcggcgtgcgctcggtgagctacctgccgctg
acctacgatcaccgcctcatcgacggtgccgacgcgggacggttcgtgaccaccatcaag
cggcgtctcgaagaaggtgcgttcgaggccgacctggggctgtag

DBGET integrated database retrieval system