KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3001Help
Entry
Mflv_3001         CDS       T00498                                 

Definition
chitinase (EC:3.2.1.14 3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
K01183  
chitinase [EC:3.2.1.14]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mflv_3001
   00520 Amino sugar and nucleotide sugar metabolism
    Mflv_3001
Enzymes [BR:mgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mflv_3001
    3.2.1.14  chitinase
     Mflv_3001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3173230..3180162
Genome map
AA seq 2310 aa AA seqDB search
MGYGRFVGRVGALAVALGIGLAVPAVAAAEPSDDSSAQSGGSDVGGPAKPDRVRATESAD
RSDDAGEPAGSDRDSDGPTDDSEDPEIDSGDREPLDEESDPVSDVEDPSVEDVPDATDSE
VSRRDGDSAEPRPENDRETPAAGPTEPSAEPDDAAIAVSDRPADAAEPVAPSDDRGMHRA
TSADQDVQTLTVSSTPARTSGQTATVSTGLTDIVTTFLRVLGIGSSAGDGSAPLPVYEVV
TAVLGAIRREMDRLFANNGPSAVLGPTSQTAPGVVTGTVIASDPEGDDLVYSVVEAPTRG
TVTVDAAGRFTYTAGTSAAAAGADTFVIGVRDAGFHLISVTPTRTQVPVTITFGADGVAT
QTISTRAARATTASAATTATGTATGTIHHITTSGPDIVGFDPARDKLDLGDVSVHNFIVV
DTAEGVGFRNPWSGETTVLQGVSLSQLTVDSFVPIINDHLRQDLSGALAWEQGVTPKANT
VYARSHEVGQIDRVAFTAATDVVDFRYYGTREQLYMSDTPDGVVISNAGTGQALILQGVT
TSQLTAKNFVFHSAQVREDRLHQQLGIGTVPDSQVLPQGVTYAGTDTWPTTAGTGQPPTG
QTGTTTKISWQYGSHTALNFDPGRDKLDFGWFKAHEFDVTEVAGSTKIAIAGNNQTYTLA
GVAIGELTTSNIIALDDSARTEWSNLIYGAGQTVSQPKLSVADAVVSEGNSGTSTLTFTV
TMSKASTDTVTVSYSTSNGSATAAGGDYVPAVGTLTFTPGQTSKTVAVTVNGDTLVEFDE
QLTLTLSAPVNATIADGTGLGTIRNDDVDQAPTTPPTVSIADLTVTEGNGDHSHFMFVAT
LSKPSTETVTVRYATSNGTATAGVDYAATTGTVTFAPGVTTQLVHVDVLGDTVVEQNETF
FVTLTNPTGATIGDGVATGTITDDDTVVTPGTGGVNSGNPGDALWGEAFFAPYVDMGAWP
VPNLLALAQQRGISLLTLGFMQATPDGKLAWAGLSALTPDSDFDQARAINQSIAALQAAG
GDVMISLGGASGTSLAQWYAAHGLGPQALADAYAAVADTYKLNRIDFDIEGSAVAEPASI
ALNAQALRLLQQLRPDLEIWYTLPVLPSGLTADGLNVVRKAIEAGVTLDGVNIMAMDYGE
SAAPTSGPNAKTMGAWAIQAAESTHAQLSTLYSGYGQTFAWNQLGVTPMIGVNDVLTEVF
TVADSQALEDFARARGLGMLSMWSLNRDYPGNIGQATTTTSGTNTPTGGFSAVFNDYGTV
NPTSGPPPAISIADLTVAEGNGAGAHAMFVVTLDKPSTQTVTVRYATSNGTAVAGTDYVA
ATGTVTFAPGVTSQTVHVGILGDTVAESAETFSVTLSNPTGATIADATAVGAITDDDGVT
PTPGANASVKYTVNDNWGSGFTASVALTAGASGMNGWTVEFDSPAQISNIWNAEIVSRVG
NHYVVRNVSYNAQVAAGQTVTFGFQASPGGGSATATNFTVNGAATGQPVVVPPKVSIADA
GVVESHSGTKNIVFVLTLDKPATSPVSVAYATSNGTATAGGDFTAASGVVTFAAGVTSQQ
ISVPVLGDTTVEADETFTVTLSNPSGVTIADGSAIGTITNDDVATPTPGNASATMVVNDN
WGSGFTATVTVKAGSSALNGWTVEFDTPAQIGNIWNAEIVSRVGNHYVVRNAAWNPKIAA
GQTVTFGFQASPGGGSATASNFTVNGQSAPAQPPTVSVADASVGESNSGTTQMTFVVTLS
RSSTSPVTVAYATSNGTATAGVDYTAKSGTVTFAPGVLSQQIQVSVTGDAAVEANETFTL
TLSNPAGATISDGSALGTIVNDDVAVPANISLSISDASVTEGAPGVGVAPGWFSTSGNQI
VDSAGRPVQIAGVNWFGMESETFAPHGLWTRNYKEMMNEMAALDFNTIRLAYSSEMLHTG
AAPNGIDFGKNPDLAGLSALQIMDKIVGYAGEIGMRVILDHHRSSKGAGPNSNGLWYEGS
YTEAAWIDDWTMLAQRYANTPTVIGADLHNEPHAGTWGGGGATDWAAAAERAGNAVLSVN
SNWLIFVEGVADHQGHSYWWGGNLMGVKDRPIVLNTPNRVVYSPHDYPNSVYAQPWFQTA
NFGAALPDKFEQMWGYIYEQNIAPIYLGELGTRLSDPKDVVWYEAITSYLSGDFDNDGTV
DIAAGTEDMSWTFWSWNPNSRDTGGILADDWRTVNTNKMAYLEAIQFDFDDSSPGVLAQF
VVSLAAASTQVVTVQYATSNQTAGAGSDYAPATGTLTFQPGETHKTITVVVFADTVMEGN
ETFLVTLSSPAGATLADGSGTGTIRDRTIV
NT seq 6933 nt NT seq  +upstreamnt  +downstreamnt
atgggctacggacgttttgttggtcgcgtcggtgcgttagctgtggcgttggggatcgga
cttgccgtccccgccgttgctgccgcagaaccctcagacgactccagtgcacagtcgggg
ggctcggacgtgggaggcccggcaaagcccgatcgtgtgcgcgcgaccgaatctgccgat
cgctcggacgacgccggcgaacccgccgggtccgaccgcgacagcgacggtccgacagac
gattccgaggatccggagatagattccggagaccgggaacccctcgacgaggagtcggat
ccggtatccgacgtcgaggatccgtccgtggaggacgtgcccgacgccaccgattccgag
gtgagccgccgcgacggcgactccgctgagccgcgtccggagaatgatcgcgaaaccccg
gccgcaggcccgacggaaccctcggccgaacccgacgacgccgcgatcgccgtgtccgac
cgtcctgcggacgcggcggagccggtggcaccgtcggatgacagaggcatgcaccgggcg
acctcggccgaccaagacgtccagacgctgaccgtgtcctccacccccgcacggacgagc
gggcagaccgccacggtgtccacggggttgaccgacatcgtcacgacattcctgcgcgtg
ttggggatcggctcctcggccggcgacggctcggctccactgcccgtctacgaggtcgtc
accgcggtgctcggggcgatccgacgggagatggacaggctcttcgccaacaacggcccg
tcggcggtgctgggcccgaccagccagaccgctcccggtgtcgtgaccggaacggtgatc
gcgtccgatcccgagggggacgacctggtctactccgtggtcgaagcccccacgcggggg
accgtcaccgtcgatgccgccgggaggttcacctacaccgccggcacgtccgcggccgcc
gcgggtgccgacaccttcgtcatcggcgtccgcgacgccggcttccacctgatctccgtc
acacccaccaggacccaggttccggtcaccatcacgttcggcgccgacggcgttgccacc
cagacgatctcgaccagggctgccagggccaccaccgcgtcggcggccacgaccgcgacc
gggacggcgaccgggacgatccaccacatcaccacctccggacccgacatcgtcggattc
gatcccgccagagacaaactcgacctcggcgatgtgtcggtgcacaacttcatcgtcgtc
gacaccgccgaaggcgtcggattccgcaatccctggtccggcgagaccaccgtcctgcag
ggcgtctcgctgagccagctgaccgtcgacagcttcgtgccgatcatcaacgaccatctg
cgccaggacctttccggggcactggcctgggagcagggagtcaccccgaaggccaacacc
gtctacgcgcgctcacacgaggtcggacagatcgaccgggtcgcgttcaccgcggcgacc
gacgtcgtcgacttccggtactacggcacccgcgaacagctctacatgtccgacaccccc
gacggggtcgtgatctccaacgcggggaccgggcaggcgctgatcctgcagggagtgacc
acaagtcagctcaccgcgaagaacttcgtcttccacagcgcacaggtgcgcgaggaccgg
ttgcaccagcaactcggcatcggcacagtgcccgattcccaggtactgccgcagggcgtc
acctacgccgggaccgacacctggcccaccaccgccggcaccggccagccgccgacgggt
cagaccggcaccacgaccaagatctcgtggcagtacggcagccacaccgcgctgaacttc
gatcccggcagggacaagctggacttcggctggttcaaggcgcacgagttcgacgtcacc
gaggtggccggatccaccaagatcgccatcgccggcaacaaccagacctacacgctggcc
ggcgtcgcgatcggcgagctcacgacgagcaacatcatcgccctcgatgacagcgcccgc
accgagtggagcaacctgatctacggtgccggacagacggtttcgcaaccgaagctgtcg
gtcgctgacgcggtcgtgtccgaggggaactccggcacctcgacgctcaccttcacggtg
acgatgtcgaaggcctccaccgacacggtcacggtcagctacagcaccagcaacggcagc
gcgaccgcagccggcggcgactacgtcccggctgtcgggacgctgacgttcacccccggc
cagacctcgaagacggtcgccgtcaccgtgaacggtgacacgctggtcgaattcgacgaa
cagctcactctcaccctgtccgccccggtgaacgcgaccatcgccgacggcaccggtctc
ggcacgatccgcaacgacgacgtggaccaggcgccgacgacaccgccgaccgtgtcgatc
gccgacctcaccgtgaccgagggcaacggcgaccacagccacttcatgttcgtcgccaca
ctgagcaagccgtcgacggagacggtgacggtgcggtacgcgacgtccaacggcaccgcg
accgccggtgtggactacgccgcgacgaccggcaccgtcacgttcgcgcccggtgtcacc
acacaactcgtgcacgtggacgtcctcggcgacaccgtggtcgagcagaacgagacgttc
ttcgtgacgctgacgaatcccaccggagcgaccatcggcgacggagtcgccaccggcacc
atcactgacgacgacacggtcgtcaccccgggcaccggcggtgtcaattccggaaacccc
ggcgacgcactgtggggcgaggccttcttcgccccctacgtggacatgggcgcctggccc
gtgcccaacctgctggctctggcgcagcagcgggggatctcgctgctcaccctgggcttc
atgcaggccacgcctgacgggaaactggcgtgggcggggttgtctgcgctgacccccgat
tcggacttcgaccaggccagggcgatcaaccagtcgatcgcggcgctgcaggccgccggc
ggcgacgtgatgatctcgctgggaggggcgtcgggcaccagcctcgcccagtggtatgcg
gcgcacggcctcggtccgcaggcgctggccgacgcgtacgccgctgtcgccgacacctac
aagctcaaccgcatcgacttcgacatcgagggttccgcggtggccgagccggcgtcgatc
gcgctgaacgcacaggcgctgcgccttcttcagcagcttcggcccgacctcgagatctgg
tacaccctgccggtgctgcccagcggtctgaccgccgacggcctcaacgtcgtgcgtaag
gcgatcgaggccggcgtgacgctcgacggcgtcaacatcatggcgatggactacggcgag
tcggcggcgcccaccagtggacccaacgcaaagaccatgggcgcctgggcgatccaggcc
gcggagtccacccacgcgcagctgagcaccctgtattcgggatacggccagaccttcgcg
tggaaccagctcggcgtgacgccgatgatcggtgtcaacgacgtgctgaccgaggtgttc
acggtggccgactcgcaggcgctggaggacttcgcccgcgcccgcggcctgggcatgctg
tcgatgtggtcgctcaaccgcgactatcccggcaacatcggtcaggcgaccacgaccacg
tccgggaccaatacgcccacaggcggtttcagcgccgtgttcaacgactacggcacggtc
aatccgacctccggtccgccgccggcgatctcgatcgccgacctcacggtggccgaaggg
aacggcgccggcgcgcacgcgatgttcgtcgtcacgctcgacaagccgtccacccagacg
gtaacggtgcggtacgcgacgtcgaacggcacggcggtcgccggcaccgattacgtggcg
gccacgggcactgtcacattcgcacccggtgtgacgtcgcagacggtgcacgtcggcatc
ctcggtgacaccgtcgcggagtccgccgaaaccttctcggtgaccctgtcgaaccccacg
ggcgcgacgatcgccgacgccaccgccgtcggcgcgatcaccgacgacgacggcgtgacg
ccgacgccgggcgcaaacgcgtcggtgaagtacaccgtcaacgacaactggggctccggg
ttcaccgcgtcggtcgcgctcaccgccggggcgtccggcatgaacgggtggacggtcgag
ttcgactcgccggctcagatcagcaatatctggaacgccgagatcgtcagccgggtcggc
aaccactacgtggtgcgtaacgtgtcgtacaacgcgcaggtggctgccgggcagaccgtc
acgttcggcttccaggcctccccgggtggcggttcggcgacggcgaccaacttcaccgtc
aacggtgcggcgaccggtcagccggtcgtggtgccgccgaaggtgtcgatcgccgatgcc
ggtgtcgtggagtcccacagcgggacgaagaacatcgtgttcgtgctgacgttggacaaa
cccgcgacctcaccggtgagtgtggcgtatgcgacgtcgaacggaacagccaccgcgggt
ggtgatttcaccgcggcgtcgggggtggtgaccttcgcggcgggggtgacctcccagcag
atctcggtgccggtgctcggtgacacgacggtggaggccgacgagacgttcacggtgacc
ctgtcgaatcccagtggcgtgacgatcgccgacggcagcgcgatcggcaccatcaccaac
gacgatgtggccacacccactccgggcaatgcgtcagccacgatggtcgtgaacgacaac
tggggatcgggtttcaccgccaccgtcaccgtcaaggccggatcgtcggcgctgaacggc
tggaccgtcgagttcgacaccccggcgcagatcggcaacatctggaacgccgagatcgtc
agccgggtcggcaatcactatgtcgtgcgcaacgcggcgtggaacccgaagatcgccgcc
ggccagaccgtgacattcgggttccaggcgtccccgggcggcgggtcggcgaccgcgtcg
aacttcacggtcaacgggcagtcggctcccgcgcaaccgcccaccgtctcggtggccgac
gcgtcggtcggcgaatcgaactccgggacgacgcagatgacgttcgtggtcacgctgtcc
agatcgtcgaccagtccggtcaccgtcgcgtacgcgacctcgaacgggacggccacggcc
ggcgtcgactacaccgcgaagtcggggacggtcacgttcgcgcccggcgtgttgtcacag
cagattcaggtctcggtcaccggcgatgccgcggtggaggcgaacgagaccttcaccctg
acgctgtcgaatcccgcgggcgcgacgatatccgacggctccgcgctcggcaccatcgtc
aacgacgacgtcgccgtaccggccaacatctcgttgagcatctccgatgcctcggtgacc
gagggcgcgccgggggtcggcgtcgcgccgggctggttctccacctccggcaaccagatc
gtcgactcggcgggacgtcccgtgcagatcgccggcgtcaactggttcggcatggagagc
gaaacctttgcgccacacggcctctggacccgcaactacaaagagatgatgaacgagatg
gcggcgttggatttcaacacgatccgactcgcgtactccagcgagatgctgcacaccggc
gcggcgcccaacggcatcgacttcggaaagaacccggacctcgcgggactgtcggcgctg
cagatcatggacaagatcgtcggctacgccggcgagatcgggatgcgcgtcatcctcgac
caccaccgcagcagcaagggcgcgggcccgaacagcaacgggctctggtacgagggctcc
tacaccgaggcggcatggatcgacgactggacgatgctcgcccagcggtatgcgaacacc
ccgacggtgatcggcgcggatctgcacaacgagcctcatgccggaacctggggcggtggc
ggcgccaccgactgggccgcagccgccgaacgcgcgggcaacgctgtgctgtcggtgaat
tcgaactggctcatcttcgtcgagggggtggccgaccaccaggggcattcctattggtgg
ggtggcaatctgatgggtgtcaaggatcgcccgatcgtgctgaacacgccgaaccgcgtc
gtgtactccccgcacgactatccgaactcggtgtacgcgcagccctggttccagaccgcg
aacttcggtgccgcgctaccggacaagttcgaacagatgtggggctacatctacgagcag
aacatcgccccgatctacctcggtgaactcggcacgcggctcagcgatcccaaggacgtc
gtctggtacgaggccatcacgtcgtacctctccggcgacttcgacaacgacggcaccgtc
gacatcgcggccggcaccgaggacatgtcgtggacgttctggtcgtggaaccccaattcc
cgggacaccggcggaatcctggccgacgactggaggacggtcaacacgaacaagatggcc
tacctggaagccatccagttcgatttcgacgacagcagcccgggcgtgctcgcgcagttc
gtggtgtcgctcgccgcggcctccacacaggtggtgacggtgcagtacgccacgtcgaac
cagaccgcgggtgccggcagcgattacgcgccggcgaccggcacgctgaccttccagccg
ggggagacccacaagacgatcaccgtggtcgtgttcgcagacacggtgatggagggcaac
gagacgttcctggtgacgctgtcgagcccggcgggcgcgacactggccgatggttccggc
accggcacgatcagggaccgcacgatcgtctaa

DBGET integrated database retrieval system