KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3047Help
Entry
Mflv_3047         CDS       T00498                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mflv_3047
Enzymes [BR:mgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Mflv_3047
Transfer RNA biogenesis [BR:mgi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Mflv_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3225582..3226370
Genome map
AA seq 262 aa AA seqDB search
MARVLTWSTDRVSITDAALAAAVAEEAGELLLAMREQIGFYDPYDLGDAGDSRANTLILD
RLRAARPGDAILSEEAVDDPSRVDADRVWIVDPVDGTYEYSMPGRADWAVHIALWRRDAG
TLTDAAVALPARGEVYRTDTVAPPPPRVDGPIRITASSNRPPAVLWHIRDELDIELYRIG
SAGAKAMAVVRGDVDAYLHAGGQWEWDSAAPAGVLWAAGLHASRLDGSPLIYNRPDPYLP
DLLMCRPEVAGRLLDVIWSAYR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcgttctgacatggtctactgaccgggtgagcatcaccgacgcagcgctggcc
gccgccgtggccgaggaagccggtgagctgctgctcgcgatgcgcgagcagatcgggttt
tacgatccgtacgacctcggcgacgccggggactcccgcgccaacacgttgatcctcgac
cggctgcgcgccgcgcggcccggcgacgcgatcctgtccgaggaagccgtcgacgacccg
tcgcgcgtcgacgccgaccgggtctggatcgtcgaccccgtcgacggcacctacgaatac
tcgatgcccgggcgggccgactgggccgtgcacatcgcgctgtggcggcgggacgcgggc
accctcaccgatgccgcggtggcgctcccggcgcgcggcgaggtgtaccgcaccgacacc
gtcgccccgccgcccccgcgcgtcgacggcccgatccggatcaccgcgagctcgaaccgg
ccgcccgcggtgctgtggcacatccgcgatgaactcgacatcgagctctaccggatcggc
tcggcgggcgccaaggcgatggcggtcgtgcgcggcgacgtcgacgcctacctgcacgcg
ggcggtcagtgggagtgggactccgcggcgccggccggggtgctgtgggccgcgggcctg
cacgcgtcccgcctcgacggatccccgctgatctacaaccggcccgatccgtatctgccg
gatctgctgatgtgccggcccgaggtcgccggccggttgctggacgtgatctggtcggcg
taccgctga

DBGET integrated database retrieval system