KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3297Help
Entry
Mflv_3297         CDS       T00498                                 

Definition
dTDP-4-dehydrorhamnose reductase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:mgi00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mgi00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3483166..3484599
Genome map
AA seq 477 aa AA seqDB search
MTDFGKTLRAVETSIPGLTLWDLPVHGDNRGWFKENWQRAKMVAAGLPDFGPVQNNISFN
QAPGTLRGIHAEPWDKFISVGSGRIFGAWVDLRSGPTFGTVFTAEIDPSRAVFVPRGVGN
AFQTLEPETVYVYLVNDHYSPGVGYPSLNPGDEALAIEWPIPLDRAEMSEKDRAQPPLSE
VTPVPGPKTLVLGADGQLGRALRAAYAEAPHVEFATRAELDLCAPDLDSARRWRDYDTIV
NAAAYTAVDAAETSEGRTAAWTVNVTGVAALARVATAHGITLVHVSSDYVFDGSAASPYR
EDDPLSPLGVYGQTKAAGDQLVSTVPRHYVVRTSWVVGEGRNFVQTMLSLAAKGVDPAVV
DDQFGRLTFTSELARAVRHLTESRAPYGTYNVSGSGTERTWADIARRTFDLAGHDPRRVR
GVSTAEYFSAATAPVAPRPARSVLDLGKIEATGFWPADMDETLTDYVRAATLHTQSV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgacggacttcgggaagaccttgcgtgccgtggagacttctatcccggggctcaccctg
tgggatctgccggtgcacggcgacaaccgcggatggttcaaggagaattggcagcgggcc
aagatggtcgccgcgggcctgcccgacttcggcccggtgcagaacaacatctcgttcaac
caggcgcccgggaccttacgcggcatccacgccgagccatgggacaagttcatctccgtc
ggttcgggccgcatcttcggcgcctgggtcgacctgcgctccggcccgaccttcggcacg
gtgttcaccgccgagatcgatccgtcgcgggctgtgttcgtgccccgcggcgtcggcaat
gcgtttcagacgctggaacccgagaccgtctacgtctacctcgtcaacgaccactactcc
cccggtgtcggctatccgtcgctgaatccgggcgacgaggcactggccatcgagtggccg
atcccgttggaccgtgccgagatgtcggagaaggaccgcgcccagccgccgctgtcggag
gtgacaccggtgccggggcccaaaacgctggttctcggcgccgacgggcaactcgggcgc
gcattgcgcgcggcgtacgcggaggcgccacacgtcgaattcgccacccgcgccgaactc
gatctgtgcgcgcccgacctcgactctgcccgccgctggcgggactacgacacgatcgtc
aacgccgcggcctacacggcggtcgacgcggccgagacctccgagggccggaccgcggcc
tggaccgtcaacgtcaccggcgtcgccgcgctggcgcgggtcgccaccgcacacgggatc
acgctcgtgcacgtctccagcgactacgtgttcgacgggtcggcggcctcgccctaccgc
gaggacgatccgctgtccccgcttggtgtgtacggccagaccaaggccgccggcgatcag
ctggtgtccaccgtgccgcgccactacgtcgtccgtacgtcgtgggtggtcggcgagggc
cgcaacttcgtgcagaccatgctctcgctggccgccaagggtgtcgaccccgccgtcgtc
gacgaccagttcggaaggctgacgttcacctcggagttggcgcgggccgtccggcacctc
accgagtcacgggcgccgtacggcacctacaacgtcagcgggtccggcaccgagaggacg
tgggccgacatcgcgcggcgcacgttcgacctggccggccacgatccgcggcgggtgcgc
ggggtgtcgaccgccgagtacttctccgcggcgacggcgccggttgcaccgcggccggcg
cgcagcgtgctggacctcggcaagatcgaggccaccggcttctggccggccgacatggac
gagacgctcaccgactacgtgcgggctgcgaccctgcacacccagagcgtctga

DBGET integrated database retrieval system