KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3367Help
Entry
Mflv_3367         CDS       T00498                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00620  Pyruvate metabolism
mgi00630  Glyoxylate and dicarboxylate metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01200  Carbon metabolism
Module
mgi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mflv_3367
   00630 Glyoxylate and dicarboxylate metabolism
    Mflv_3367
Enzymes [BR:mgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mflv_3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABP45843
JGI: Mflv3367
UniProt: A4TAC4
Position
3552882..3555098
Genome map
AA seq 738 aa AA seqDB search
MTDRVTVGNLRVSPVLYDFINNEALPGTDIDPDTFWSGVDKIVADLTPKNQDLLARRDHL
QAQIDKWHRARVIGGFEAEDYKQFLTEIGYLEPEPADFSVTTSGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISDEDGAEAGSSYNKRRGDKVIAYARRFLDGAA
PLASGSWTDITGLRIDDGAVSATLDDGGSVALADPQQFVGYHGEPDAPTAVLLANNGLHI
EILIDADSPIGSTDKAGIKDVVLESAITTIMDFEDSVAAVDADDKVLAYRNWLGLNRGDL
AEEVSKGGKTFTRVLNSDRTYRAPDGETELTLPGRSLLFVRNVGHLMTNDAIVVDDNGAD
GAEVPEGIQDALFTSLIGIHGLRSAGDDDTKNGPLLNSRTGSIYIVKPKMHGPDEVAFTC
ELFSRVEDVLGLPQNTIKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHT
SMEAGPMIRKGAMKSTDWIAAYENQNVDIGLETGLSGKAQIGKGMWAMTDLMADMVEQKI
GQPKAGATTAWVPSPTAATLHAMHYHQVDVFAVQSELAGKRRSTLDQLLTIPLATELAWA
PEEIREEVDNNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRH
GVITEEDVKTSLRRMAAVVDEQNAADPDFRPMASDPDNSIAFQAAQELILDGAAQPSGYT
EPILHRRRREYKAASNVG
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgcgtgacggtgggcaacctgcgcgtctctcccgtgttgtacgacttcatc
aacaacgaggcgttgccgggtaccgacatcgaccccgacacgttctggtccggtgtcgac
aagatcgtcgccgacctgacgcccaagaaccaggacctgctcgcccggcgcgaccatctg
caggcccagatcgacaagtggcaccgcgcgcgggtgatcggcggattcgaggccgaggac
tacaagcagttcctcaccgagatcggctacctggaacccgagcccgccgacttctccgtc
accacctccggcgtcgacgacgagatcaccaccaccgcgggcccgcagctcgtcgtgccg
atcctcaacgcccgcttcgcactcaacgccgccaacgcccgttggggttcgctctatgac
gccctctacggcaccgacgtcatctccgacgaggacggcgccgaggcgggcagctcgtac
aacaagcggcgcggcgacaaggtcatcgcctacgcgcgcaggttcctcgacggcgcggcc
ccactggcgtccggatcgtggacggacatcaccggccttcgcatcgacgacggggcggtg
agcgcgacgctcgacgacggcggctcggtcgcgctggccgacccgcagcagttcgtcggc
taccacggcgaacccgacgcgccgaccgcggtgctgctggccaacaacggcctgcacatc
gagatcctgatcgatgccgactcccccatcggctccaccgacaaggccggcatcaaggac
gtcgtgctggagtccgccatcaccacgatcatggacttcgaggattccgtggcggccgtc
gacgccgacgacaaggtgctggcctaccggaactggttggggctcaaccgcggtgacctc
gccgaagaggtcagcaagggcggcaagacgttcacccgggtgctcaactccgaccgcacc
taccgtgctcccgacggcgagaccgagctcactctgcccggccggagcctgctgttcgtg
cgcaacgtgggtcacctgatgaccaacgacgcgatcgtggtcgacgacaacggtgccgac
ggcgccgaggtccccgagggcatccaggacgcgctgttcaccagcctcatcggcatccac
ggtctgcggtccgccggcgacgacgacaccaagaacggcccgctgctcaacagtcggacc
gggtcgatctacatcgtgaagcccaagatgcacgggcccgacgaggtcgcgttcacctgt
gagctgttcagccgcgtcgaggacgtcctcggtctgccgcagaacaccatcaaggtcggc
atcatggacgaagagcgccgcacgacgctgaacctgaaggcgtgcatcaaggccgccgcc
gaccgcgtcgtgttcatcaacaccggattcctcgaccgcacgggcgatgagatccacacg
tcgatggaagcgggcccgatgatccgcaagggcgcgatgaagtcgaccgactggatcgcc
gcctacgagaatcagaacgtcgacatcggcctggagaccgggctgtccggtaaggcccag
atcggcaagggcatgtgggccatgaccgacctgatggccgacatggtcgagcagaagatc
ggccagcccaaggccggcgccaccaccgcgtgggtgccctcgccgaccgcggccaccctg
cacgcgatgcactaccaccaggtcgatgtgttcgcggtgcagtcagaactcgccggcaaa
cgccgctcgactctcgaccaactcctgaccattccgctggccacggaactggcctgggcg
ccggaggagatccgcgaggaggtcgacaacaactgccagtcgatcctcggctacgtcgtg
cgctggatcgacgcgggtgtcggctgctcgaaggtgcccgacatccacgacgtcgcgttg
atggaagaccgtgcgacactgcgtatctcgagtcagctgctggccaactggctgcgccac
ggcgtgatcaccgaagaggacgtcaagaccagcctgcggcgcatggcggccgtggtcgac
gagcagaacgccgcggaccccgacttccggccgatggcatccgatcccgacaacagcatc
gcgttccaggcggcccaggaactgatcctcgacggcgcggcgcagcccagcggctacacc
gagccgatcctgcaccgcaggcgccgggagtacaaggcagctagtaacgttggctga

DBGET integrated database retrieval system