KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3421Help
Entry
Mflv_3421         CDS       T00498                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mgi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3638055..3640181
Genome map
AA seq 708 aa AA seqDB search
MSPSLTELAARYGVATEYTDWTGGSVRVSASTLIGVLDALGVPATTEREREAALAEHDRG
YWGRALPATVVGRAGAATPFWVHVTHGDPARLWLRLEDGSVRTGLRQLENNRPPFDLDGR
LVGEASFELPPDLPIGYHRLHLQIGSQDVSTAVIVAPASLPERPVGRTWGLSTQLYSVRS
RRSWGTGDLTDLADIAVWSAARHGAGFVLVNPMHAASPVAPMEPSPYLPTSRRFVNPLYL
RVEAVPEYAYVRHRSRIRKAQTQVQARAARSGQIERDRAWKAKRAALETVYLVERSPGRE
IAYRAFRQRQGRSLDDFATWCVLAEKHGADWHQWPEELRHPRTEAVSAFAQKHSKDIDFH
CWLQWLVDEQLSAAQDSAVRAGMDLGIMHDLAVGVDPDGADAWALQDVLALGVTAGAPPD
EFNQLGQDWSQPPWRPDRLAEAAYEPFRALVNAVLRHAGGVRIDHIIGLFRLWWIPKGAL
PLEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDHLRDRGLFGTSILWFEM
TEEGRQPLPAERWREFCLSAVTTHDLPPTAGYLAGEHVRLRDELGLLTRPAEEELAGDRE
HQQAWRAELRRVGLLGGDAESEADVDETVLALHRYLGLTPSRLLALSLADAVGEVRTQNQ
PGTTDEYPNWRVPLAGPDGRQVLLDDIFDDPRAAALCEAMRAAVTPPA
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
gtgtccccgtccctgaccgaactcgcggcgcggtacggggtcgcgaccgagtacacggac
tggaccggcgggtccgtacgggtgtcggcgtccacgctgatcggggtgctcgacgcgctc
ggcgtgcccgccaccaccgagcgcgagcgcgaagccgccctggccgagcacgaccgcggc
tactggggccgcgcgctgccggcgacggtggtggggcgcgccggtgcggccacaccgttc
tgggtgcatgtcacccacggcgacccggcccggttgtggctgaggctcgaagacggcagc
gtccgtaccggtctgcgacaactcgaaaacaacaggccgccattcgatctcgatggtcgg
ctggtgggagaggcgtcgttcgagcttccccccgacctgccgatcggctaccaccggctg
cacctgcagatcggctcgcaggacgtgagcacggcggtgatcgttgcgcccgcctcgctc
ccggagcgcccggtgggccgcacctgggggctgtccacccagttgtacagcgtgcggtcc
cggcggtcctggggcacaggcgatctgaccgacctcgccgatatcgcggtgtggtcggca
gcgcgtcacggcgcgggcttcgtgctggtgaacccgatgcatgccgcctcaccggtggcg
ccgatggagccctcgccctacctgccgacgtcacgccggttcgtcaatccgctgtatctg
cgggtggaggcggtgcccgaatacgcctacgtgcgccaccgcagccggatccgcaaggct
cagacgcaggtgcaggcgcgcgccgcccgctccgggcagatcgagcgcgaccgcgcgtgg
aaggccaagcgtgccgcgctggagacggtgtatctcgtggagcgttcgccggggcgggag
atcgcctatcgggcgttccggcaacggcagggccgcagtctcgatgatttcgcgacgtgg
tgtgtgctggccgagaaacacggtgccgactggcatcagtggcccgaggaactgcgacac
ccgcgcaccgaggcggtgtcggcgttcgcccaaaagcattccaaggacatcgatttccac
tgctggctgcaatggctggtcgacgaacagctctcggccgcccaggactccgcggtgcgg
gcaggcatggatctgggcatcatgcacgacctcgccgtgggagtggatcccgacggcgcg
gacgcgtgggccctgcaggacgtgctcgctctcggtgtcaccgcgggcgctcccccggac
gagttcaaccagctcggtcaggattggtcgcagccgccgtggcggcccgaccgtctcgcg
gaggcggcatacgaaccgttccgtgcgctggtcaacgctgtgctgcggcatgccggtggg
gtgcggatcgaccacatcatcgggttgttccggctgtggtggatcccgaagggtgcactg
ccgctggaaggtacgtacgtgcggtacgaccatgaggcgatgatcggcatcgtcgcgttg
gaggcccaccgggccggcgcggtcgtcgtcggcgaggacctcgggacggtcgagccgtgg
gtgcgtgaccatctgcgtgatcgcggtctcttcggcacgtcgatcctgtggttcgagatg
accgaggagggacggcagcccctgccggcggaacgctggagggagttctgcctgtcggcg
gtgacgacacacgacctgccgcccaccgcgggttatctggccggcgaacatgtccggctg
cgcgacgagctgggcctgctgacccgccccgccgaggaggagctggccggcgaccgggag
caccagcaggcctggagggcggagttgcggcgagtcgggctgcttggcggcgatgccgag
tcggaggccgacgtcgacgagacggtgctggcgctgcaccgctacctgggattgacgccg
tcgcggctgctggcgctgtcgttggccgacgcggtcggcgaggtgcgcacccagaatcag
ccgggtacgaccgatgagtatccgaactggcgggtgccgctcgccgggccggacggcagg
caggtgctgctcgacgacatcttcgacgacccgcgtgcggcggccctctgtgaggcgatg
cgcgccgcggtgacgccacccgcctga

DBGET integrated database retrieval system