KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3499Help
Entry
Mflv_3499         CDS       T00498                                 

Definition
catechol O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mflv_3499
Enzymes [BR:mgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     Mflv_3499
Exosome [BR:mgi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Mflv_3499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3726154..3726891
Genome map
AA seq 245 aa AA seqDB search
MNALRRWARLALGMRSFVRTGQMGDGRESACADHVETHAAPGDIDAALSAIDGFAVREAV
LVNVGVEKGALLDAAVRRADPALALELGTYCGYSALRIARAAPSARVLSVEFSAANAEVA
RRIWTHAGVADRVTCVVGTLGDGGRTLDSLAGEHGVGPGSVDLLFIDHDNSAYLSDLLSI
EQRGWLHRGSLVVADNVRIPGAPEYRRYMREHEGTRWHTVEHKTHVEYQSLLPDLVLESE
YLVGS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccttcggcggtgggcgcggctggcgctcggcatgcggtcgttcgtgcgcacc
ggccagatgggcgacggcagggagagcgcgtgcgccgaccacgtcgagacccacgccgca
cccggcgacatcgacgcagcgctctcggcgatcgacgggttcgccgtccgggaggccgtg
ctggtcaatgtcggtgtcgaaaaaggtgcgctgctcgacgccgcggtgcgtcgggcggac
ccggccctggctctggaactgggcacctactgcgggtacagcgccctgcggatcgcccgg
gccgctccgtctgcacgggtgctctccgtcgagttctccgccgccaacgccgaggtcgcg
cgacggatctggacccacgccggggtggccgaccgcgtcacctgcgtcgtcggcacgctc
ggagacggcgggcgcaccctcgacagcctcgccggagaacacggcgtcggccccggcagc
gtcgacctgctgttcatcgaccacgacaacagcgcctacctgtccgatctgctgagcatc
gagcagcgcggctggctgcaccgcgggtcactcgtggtcgccgacaacgtgcggatcccc
ggcgccccggagtaccggcgctacatgcgcgagcacgagggcacccgctggcacaccgtc
gagcacaagacgcacgtcgagtaccagtcgttgctcccggacctggtgctggagtcggag
tacctggtcggcagttag

DBGET integrated database retrieval system