KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3598Help
Entry
Mflv_3598         CDS       T00498                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mflv_3598 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mflv_3598 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mflv_3598 (trpA)
Enzymes [BR:mgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mflv_3598 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3841513..3842301)
Genome map
AA seq 262 aa AA seqDB search
MSRLAGLFDSCRAEGRSGLIGYLPTGFPDVDTSIQAMVALVESGCDIVEVGVAYSDPGMD
GPVIAAATEVALRGGVRVHDAFRAVEAISNAGGKAVVMTYWNPVLRKGVDTFARDLASAG
GLGLITPDLIPDEADDWFAASEAHDLDRIFLVAPSSTPERLAETVQASRGFVYAASTMGV
TGARDAVSNAAPELVARVKAISDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALKE
GIPAVRSLTAELADGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctggccgggctgttcgactcctgccgtgccgagggccgttcggggctgatc
ggctatctgcccaccgggtttccggatgtcgacacgtcgatccaggcgatggtcgcgctg
gtcgagtctggctgcgacatcgtcgaggtgggtgtcgcatactcggaccccggcatggac
ggtccggtcatcgcggcggcgaccgaagtcgcgctgcgcggcggcgtccgggtgcacgac
gcgttccgcgctgtcgaggcgatcagcaatgccggcggcaaggcggtcgtaatgacgtac
tggaatccggtgttgcgcaagggagtcgacacgttcgcccgtgacctggcgtcggcaggc
gggctcgggttgatcacgccggacctgatccccgacgaggccgacgactggttcgccgcc
tccgaggcacacgatctggaccggatcttcctggtggccccgtcgtcgacgccggagcgt
ctcgccgagacggtgcaggcgtcccgcggattcgtctacgcggcgtccacgatgggcgtc
accggcgcacgcgacgcggtgtccaacgccgcgccggagctcgtcgcgcgcgtgaaggcc
atctcggacatcccggtcggtgtggggctgggcgtgcgctcccgtgagcaggcagcagag
atcggcgcctacgccgacggcgtcatcgtcggatcggcactggtgtcggcgctcaaggag
ggcatccccgcggtgcgctcgctgacagcggaacttgcagacggcgtacggcagaggatc
actgcgtga

DBGET integrated database retrieval system