KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3600Help
Entry
Mflv_3600         CDS       T00498                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01130  Biosynthesis of antibiotics
mgi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mflv_3600
Enzymes [BR:mgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mflv_3600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase NanE
Motif
Other DBs
NCBI-ProteinID: ABP46074
JGI: Mflv3600
UniProt: A4T9N5
Position
complement(3843561..3844379)
Genome map
AA seq 272 aa AA seqDB search
MGSATVLDSILEGVRADVAAREAVVSLAEVKARAERAPAPLDVMAALRAPGIAVIAEVKR
ASPSRGELASIADPAELASAYESGGARAISVLTEQRRFNGSLDDLDAVRAAVSIPVLRKD
FIVRPYQIHEARAHGADLLLLIVAALEQPALESLLERTESLGMTALVEVHTEEEADRALQ
AGASLIGVNARNLKTLEVDRDCFARIAPGLPTNVIKIAESGVRGTADLLAYAGAGADGVL
VGEGLVTSGDPRSAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgaccgtcctcgattccatcctcgagggagtgcgcgctgacgtcgctgcc
cgcgaggctgtcgtcagcttggccgaggtcaaagcgagagctgagcgcgcgcctgcgccg
ctcgacgtcatggccgcgcttcgcgcgccgggcatcgcggtgatcgccgaggtgaagcgg
gccagcccgtcacgcggcgagctggcgtcgatcgccgatcccgccgaactggccagcgcc
tacgagagcggcggagcgcgcgcgatcagcgtgctgaccgagcagcgccgcttcaacgga
tcgctcgacgacctggacgcggtccgcgcggcggtgtcgattccggtgctgcgcaaggac
ttcatcgtccggccctaccagatccacgaggcgcgggcgcacggcgccgatctgctgctg
ctcatcgtggcggcgctggagcagcccgccctggagtcgctgctggaacgcaccgagtct
ctcgggatgaccgcgctggtcgaggtgcacaccgaggaagaggcggatcgcgcactgcag
gcgggtgcgtcgctcatcggcgtgaacgctcgcaacctcaagacccttgaggtcgacagg
gactgcttcgcgcgcatcgcgccgggtctgccgaccaacgtgatcaagatcgccgagtcg
ggcgtgcgcggtaccgccgacctgctcgcctacgccggggccggcgccgacggtgttctc
gtcggcgagggcctggtgaccagcggcgacccgcgcagcgcggtggccgacctggtgacc
gccggtacccatccgtcctgcccgaaacccgctcgctaa

DBGET integrated database retrieval system