KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3708Help
Entry
Mflv_3708         CDS       T00498                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mflv_3708 (tpiA)
   01230 Biosynthesis of amino acids
    Mflv_3708 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_3708 (tpiA)
   00051 Fructose and mannose metabolism
    Mflv_3708 (tpiA)
   00562 Inositol phosphate metabolism
    Mflv_3708 (tpiA)
Enzymes [BR:mgi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mflv_3708 (tpiA)
Exosome [BR:mgi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mflv_3708 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mflv_3708 (tpiA)
  Exosomal proteins of melanoma cells
   Mflv_3708 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3954424..3955209)
Genome map
AA seq 261 aa AA seqDB search
MTRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDRVDVTVIPPFTDLRSVQTLVDGD
KLRLTYGAQDVSQHDSGAYTGEISGAFLAKLGCTFAVVGHSERRTYHGETDELVAAKATA
ALKHGLTPIVCIGEQLEVREAGNHVEFNVNSLRGSLAGLSAEQIAQTVIAYEPVWAIGTG
RVASAADAQEVCKAIRDELGNLASADVAAGVRVLYGGSVNAKNVGEIVGQGDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgacccgtaagccgctgatcgccggcaactggaagatgaacctgaaccacttcgaggcg
atcgcgctggttcagaaaatcgcattctcgttgccggacaagtacttcgaccgggtggac
gtcacggtgatcccgccgttcaccgatctgcgcagcgtgcagacgctcgtcgacggcgac
aagctgcgactcacctacggcgcccaggacgtgtcccagcacgattcgggcgcctacacc
ggcgagatcagcggcgcgttcctggcgaagctgggctgcacgttcgccgtcgtcgggcac
tccgaacgccgcacctaccacggtgagaccgacgagctggtcgccgcgaaggccactgcg
gcgctcaagcacggtctgaccccgatcgtgtgcatcggcgaacaactcgaggtgcgcgag
gccggcaaccacgtcgagttcaacgtgaactcgctgcgcggctcgctggccgggctctcc
gccgagcagatcgcccagacggtcatcgcctacgagccggtgtgggcgatcggcaccggc
cgggtggccagtgccgccgacgcgcaggaagtgtgcaaggccatccgcgacgaattgggc
aacctcgcgtcggccgacgtcgccgcaggtgtccgggttctctacggcggatcggtcaac
gccaagaacgtcggcgagatcgtcggccagggcgacgtcgacggcgcactggtcggcggg
gcgtcgctggacggtgagcagttcgccacgttgtcggcgatcgccgcgggcggcccgctg
ccctga

DBGET integrated database retrieval system