KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3708Help
Entry
Mflv_3708         CDS       T00498                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00010  Glycolysis / Gluconeogenesis
mgi00051  Fructose and mannose metabolism
mgi00562  Inositol phosphate metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01200  Carbon metabolism
mgi01230  Biosynthesis of amino acids
Module
mgi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mgi_M00002  Glycolysis, core module involving three-carbon compounds
mgi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_3708
   00051 Fructose and mannose metabolism
    Mflv_3708
   00562 Inositol phosphate metabolism
    Mflv_3708
Enzymes [BR:mgi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mflv_3708
Exosome [BR:mgi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mflv_3708
  Exosomal proteins of bladder cancer cells
   Mflv_3708
  Exosomal proteins of melanoma cells
   Mflv_3708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABP46180
JGI: Mflv3708
UniProt: A4TC25
Position
complement(3954424..3955209)
Genome map
AA seq 261 aa AA seqDB search
MTRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDRVDVTVIPPFTDLRSVQTLVDGD
KLRLTYGAQDVSQHDSGAYTGEISGAFLAKLGCTFAVVGHSERRTYHGETDELVAAKATA
ALKHGLTPIVCIGEQLEVREAGNHVEFNVNSLRGSLAGLSAEQIAQTVIAYEPVWAIGTG
RVASAADAQEVCKAIRDELGNLASADVAAGVRVLYGGSVNAKNVGEIVGQGDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgacccgtaagccgctgatcgccggcaactggaagatgaacctgaaccacttcgaggcg
atcgcgctggttcagaaaatcgcattctcgttgccggacaagtacttcgaccgggtggac
gtcacggtgatcccgccgttcaccgatctgcgcagcgtgcagacgctcgtcgacggcgac
aagctgcgactcacctacggcgcccaggacgtgtcccagcacgattcgggcgcctacacc
ggcgagatcagcggcgcgttcctggcgaagctgggctgcacgttcgccgtcgtcgggcac
tccgaacgccgcacctaccacggtgagaccgacgagctggtcgccgcgaaggccactgcg
gcgctcaagcacggtctgaccccgatcgtgtgcatcggcgaacaactcgaggtgcgcgag
gccggcaaccacgtcgagttcaacgtgaactcgctgcgcggctcgctggccgggctctcc
gccgagcagatcgcccagacggtcatcgcctacgagccggtgtgggcgatcggcaccggc
cgggtggccagtgccgccgacgcgcaggaagtgtgcaaggccatccgcgacgaattgggc
aacctcgcgtcggccgacgtcgccgcaggtgtccgggttctctacggcggatcggtcaac
gccaagaacgtcggcgagatcgtcggccagggcgacgtcgacggcgcactggtcggcggg
gcgtcgctggacggtgagcagttcgccacgttgtcggcgatcgccgcgggcggcccgctg
ccctga

DBGET integrated database retrieval system