KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3918Help
Entry
Mflv_3918         CDS       T00498                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00860  Porphyrin and chlorophyll metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mflv_3918
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Mflv_3918
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Mflv_3918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO
Motif
Other DBs
NCBI-ProteinID: ABP46389
JGI: Mflv3918
UniProt: A4TCT1
Position
complement(4178037..4179401)
Genome map
AA seq 454 aa AA seqDB search
MSVAARYCVVGGGISGLVAAYRLRVAAGPDAVITVLDPADRLGGILRTERIGGQAIDVGA
EAFVARRPEVPALLGELGLSGRQITTTGARPLIYSEGRLHQLPTDTVNGIPSRPSALSGL
VDDATVRWMLDEPRRPLVWRSGADPTVAELVGERFGEQVVVRSVDPLLAGVYAGSAATIG
MRAAAPTVAAALDNGARSLTEAVVAALPPPRAGSVFGAIDGGYQVLLDELVRRSGLQWAQ
VAARGVHPVRAGWEVVDDEGGHWPADAVVLAVPAPRLPALLAELAPHSADIARRIPVASA
AVVALALPGGTPLPEQSGVLVAGRGPLHTKAVTLSSRKWGRRGSAEMLRLSYGRFGDDLA
RSTGDDELLAWADEDLATLFGIAVEPVDARVVRWIDAMPQYGPGHADRVADLRAGLPRGL
AVAGAYLDGIGVPACVASAARAVASLVAGSSVGQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttgcggcgcggtactgcgttgtcggcggaggcatctcgggcctcgtcgccgcc
taccggctgcgggtggccgccgggccggacgcggtgatcacggtgctcgatcccgccgac
cgcctcggcgggatcctgcggaccgaacgcatcggcgggcaggccatcgacgtcggggct
gaggcattcgtggcacgccggccggaggtgccggcgctgctgggtgaactggggctgtcc
ggcaggcagatcaccaccaccggcgcgcggccgctgatctacagcgagggacgcctgcac
caacttcccaccgacaccgtcaacggcatcccgtcgcggccgtcggcgctgagcggcctc
gtcgacgacgcgaccgtgaggtggatgctcgacgaaccgcggcgtccgctggtgtggcgg
tcgggcgccgacccgacggtggccgagctggtcggtgaaaggttcggcgagcaggtcgtg
gtgcggtcggtcgatccgctgctggccggggtctatgccgggtcggccgcgaccatcggc
atgcgggccgccgcgcccaccgtcgccgcggccctcgacaacggcgcccgcagcctcacc
gaggccgtggtcgcggcgctgccgccgccgcgcgcggggtcggtgttcggtgcgatcgac
ggcggctatcaggttctgctcgacgagctggtgcgccgctcgggtctgcagtgggcgcag
gtcgcggcccgcggcgtgcaccccgtgcgcgccggctgggaggtcgtcgacgacgagggc
ggccactggcccgccgacgccgtcgtgctcgcggtgccggcgccgcgactgcccgcgctg
ctggccgagctggctccgcacagcgcggacatcgcccgccggatcccggtggcctccgct
gcggtcgtcgcgctggcgctgcccggcgggacgccgctgcccgagcagtccggcgtgctg
gtggccggccgtggacccctgcacaccaaggcggtgacgctgtcgtcgcgcaagtggggc
cggcgcggcagcgccgagatgctgcgactgtcctacgggcgcttcggcgacgatctggcg
cgcagcacgggcgacgacgagctgctggcctgggccgacgaggacctggccacgttgttc
ggcatcgcggtggaaccggtcgacgcccgggtggtccggtggatcgacgcgatgccgcag
tacgggccgggccacgccgaccgcgtcgcggacctgcgtgccggtctgccgcgggggctg
gccgtcgccggtgcctacctcgacggcatcggtgtgcccgcgtgcgtggcgtcggcggcc
agggcggtggcgtcgttggtcgccggttcgtcagtgggacaatga

DBGET integrated database retrieval system