KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3938Help
Entry
Mflv_3938         CDS       T00498                                 

Definition
polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mflv_3938
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_3938
   00520 Amino sugar and nucleotide sugar metabolism
    Mflv_3938
Enzymes [BR:mgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mflv_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4197572..4198375
Genome map
AA seq 267 aa AA seqDB search
MTADAEPSSSVPQRRGFGIDVGGSGVKGGIVDLDTGALIGERFKLLTPQPATPEAVAKTI
ADVVAHFEWTGPLGVTYPGVVADGIVRTAANVDKAWIGLNAKEVISAALGGQSVTVLNDA
DAAGLAEEKFGAGRNNTGVIVLLTFGTGIGSAVIHNGVLLPNTEFGHLEVGGKEAEHRAA
SSVKERKEWTHERWTVEVTKVLVAIENAIWPDLFIAGGGISRKAAKWIPLLKNRVPVVAA
ELQNTAGIVGAAMAAESDVTATGREHH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgacgccgagccatcgagctccgtgccccagcgccgcggtttcggcatcgac
gtgggcggcagcggtgtcaaaggcgggatcgtcgacctcgacaccggcgcgttgatcggt
gagcggttcaagctgctgaccccgcagcccgccacgcccgaggccgtcgccaagaccatc
gccgacgtcgtcgcccacttcgagtggacgggtcccctcggcgtcacctaccccggcgtc
gtcgccgacgggatcgtgcgcacggccgccaacgtcgacaaggcctggatcgggctgaac
gccaaggaggtcatctccgccgccctcggcggccagtcggtgaccgtgctcaacgacgcc
gacgccgcgggactcgccgaggagaagttcggcgccggacgcaacaacaccggcgtgatc
gtgttgctgaccttcgggacgggaatcggctcggcggtgatccacaacggagtgctgctg
cccaacaccgagttcggacacctcgaagtcggcggcaaagaggccgagcaccgcgccgcc
agctcggtgaaggaacgcaaggaatggacccacgagcgctggaccgtggaggtcacgaaa
gtgctggtggccatcgagaacgcgatctggccggacctgttcatcgccggcggcggcatc
agccgcaaggccgccaagtggatcccgctgctgaagaaccgggtgcccgtcgtcgccgcc
gaattgcagaacaccgcgggcatcgtcggcgccgcgatggccgctgagtccgacgtcacg
gccaccggcagagaacaccactga

DBGET integrated database retrieval system