KEGG   Mycobacterium gilvum PYR-GCK: Mflv_3938Help
Entry
Mflv_3938         CDS       T00498                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00010  Glycolysis / Gluconeogenesis
mgi00520  Amino sugar and nucleotide sugar metabolism
mgi01100  Metabolic pathways
mgi01110  Biosynthesis of secondary metabolites
mgi01120  Microbial metabolism in diverse environments
mgi01130  Biosynthesis of antibiotics
mgi01200  Carbon metabolism
Module
mgi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mgi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_3938
   00520 Amino sugar and nucleotide sugar metabolism
    Mflv_3938
Enzymes [BR:mgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mflv_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABP46409
JGI: Mflv3938
UniProt: A4TCQ9
Position
4197572..4198375
Genome map
AA seq 267 aa AA seqDB search
MTADAEPSSSVPQRRGFGIDVGGSGVKGGIVDLDTGALIGERFKLLTPQPATPEAVAKTI
ADVVAHFEWTGPLGVTYPGVVADGIVRTAANVDKAWIGLNAKEVISAALGGQSVTVLNDA
DAAGLAEEKFGAGRNNTGVIVLLTFGTGIGSAVIHNGVLLPNTEFGHLEVGGKEAEHRAA
SSVKERKEWTHERWTVEVTKVLVAIENAIWPDLFIAGGGISRKAAKWIPLLKNRVPVVAA
ELQNTAGIVGAAMAAESDVTATGREHH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgacgccgagccatcgagctccgtgccccagcgccgcggtttcggcatcgac
gtgggcggcagcggtgtcaaaggcgggatcgtcgacctcgacaccggcgcgttgatcggt
gagcggttcaagctgctgaccccgcagcccgccacgcccgaggccgtcgccaagaccatc
gccgacgtcgtcgcccacttcgagtggacgggtcccctcggcgtcacctaccccggcgtc
gtcgccgacgggatcgtgcgcacggccgccaacgtcgacaaggcctggatcgggctgaac
gccaaggaggtcatctccgccgccctcggcggccagtcggtgaccgtgctcaacgacgcc
gacgccgcgggactcgccgaggagaagttcggcgccggacgcaacaacaccggcgtgatc
gtgttgctgaccttcgggacgggaatcggctcggcggtgatccacaacggagtgctgctg
cccaacaccgagttcggacacctcgaagtcggcggcaaagaggccgagcaccgcgccgcc
agctcggtgaaggaacgcaaggaatggacccacgagcgctggaccgtggaggtcacgaaa
gtgctggtggccatcgagaacgcgatctggccggacctgttcatcgccggcggcggcatc
agccgcaaggccgccaagtggatcccgctgctgaagaaccgggtgcccgtcgtcgccgcc
gaattgcagaacaccgcgggcatcgtcggcgccgcgatggccgctgagtccgacgtcacg
gccaccggcagagaacaccactga

DBGET integrated database retrieval system