KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4066Help
Entry
Mflv_4066         CDS       T00498                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mgi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4318938..4320743
Genome map
AA seq 601 aa AA seqDB search
MCGATGEVRLDGTSPDVRAVAAMAEVMVPRGPDAAGAWSQGRVALGHRRLKIIDLTEAGA
QPMVDSDLGLTIAWNGCIYNYEELRDELAGHGYRFFSHSDTEVLLKGYHHWGDRFVDHLK
GMFAFAIVERDSGRVLLGRDRLGIKPLYLTLTPDRIRFASSLPALLAGGGVDTRIDPVAL
HHYMTFHSVVPAPHTILRGVTKLPPASLMAIEPDGRITTTTYWEPDFTRHADRADWSEKD
WEEATLDSLRTAVKRRLVADVPVGCLLSGGVDSSLIVGLLAEAGQHGLATFSIGFESVNG
VAGDEFKYSDIIAQRFGTDHHQIRIDTARMLPALDGAIGAMSEPMVSHDCVAFYLLSQEV
AKHVKVVQSGQGADEVFAGYHWYPPMGEPAAASLEGSVASYRGAFFDRDRAGYADIVAPG
YLTGDDPSELFVTEHFARAGAETGVDRALRLDTTVMLVDDPVKRVDNMTMAWGLEGRVPF
LDHELVELAATCPPQYKTAHEGKGVLKQAARQVIPSEVIDRPKGYFPVPALTHLEGPYLE
LVRDALYAPVAKERGLFRPDAVERLLADPNGRLTPLRGNELWQIALLELWLQRHGITGAA
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggagccaccggcgaggtaagactcgacggcacaagcccagatgtccgagctgtc
gcagccatggccgaggtcatggtcccccgcggtcccgacgccgccggcgcctggtcgcag
ggccgggtggccctgggccaccggcgcctcaagatcatcgatctcaccgaggcgggcgcc
cagccgatggtcgactccgatctcggtctgacgatcgcctggaacggctgcatctacaac
tacgaggagttgcgcgacgagctcgccggtcacggctaccgcttcttctcccacagcgac
accgaggtgctgctgaagggttatcaccactggggtgaccgcttcgtcgatcacctcaag
ggcatgttcgccttcgcgatcgtggaacgtgacagtggacgcgtgctgctgggccgcgac
cgcctcggcatcaagcccctctacctcaccctgaccccggaccggatccggttcgcgtcg
tcgctgcccgcgctgctcgccggcggcggtgtcgacacccgcatcgatcccgtcgcactg
caccactacatgacgttccattccgtggtgcccgcgccgcacaccatcctgcgcggtgtc
acgaagcttccgccggcgtcgctgatggcgatcgagccggatggcaggatcacgacgacc
acctactgggagcccgacttcacccggcatgccgaccgggccgactggtccgagaaggac
tgggaggaagcgactctcgactcgctgcggaccgccgtgaagcgacgcctggtcgccgac
gtccccgtcggctgcctgctctcgggcggggtcgactccagcctgatcgtcggtctgctc
gccgaggccggccagcacggcctggcgaccttctcgatcggcttcgagtcggtcaacggc
gtcgccggcgacgagttcaagtactccgacatcatcgcccaacgcttcggcaccgaccat
caccagatccgcatcgacaccgcccgcatgctgcccgccctcgacggtgcgatcggcgcg
atgagcgagccgatggtcagccacgactgcgtggcgttctatctgctcagccaggaggtc
gccaagcacgtcaaggtcgtgcagtcgggtcagggcgccgacgaggtgttcgccggctac
cactggtatccgccgatgggcgagccggcggccgcatcgctggaaggctcggtcgccagc
taccgcggggcgttcttcgaccgcgaccgggcgggttacgccgacatcgtggcgccgggc
tacctcaccggcgacgacccgagcgagttgttcgtcaccgagcacttcgcccgggccggt
gccgagaccggggtcgaccgcgcgctgcgtctggacaccacggtgatgttggtcgacgac
ccggtcaagcgcgtggacaacatgacgatggcgtggggcctggagggccgcgtcccgttc
ctcgaccacgagctcgtcgagctcgccgccacctgcccgccgcagtacaagactgcccac
gagggcaagggcgtcctcaaacaggctgcgcgccaggtcattccgtccgaggtcatcgac
cggccgaagggctatttcccggtcccggcgctgacgcacctggagggtccgtatctggag
ctggtccgtgacgcgctctacgcgccggtggccaaggaacgcggcctgttccggccggac
gcggtcgagcggctgctggccgatcccaacggcaggctgacgccgttgcggggcaacgaa
ctctggcagatcgcgctgctggaactgtggttgcagcgccacggcatcaccggcgccgcc
gcatga

DBGET integrated database retrieval system