KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4245Help
Entry
Mflv_4245         CDS       T00498                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mflv_4245
   01230 Biosynthesis of amino acids
    Mflv_4245
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_4245
   00030 Pentose phosphate pathway
    Mflv_4245
   00051 Fructose and mannose metabolism
    Mflv_4245
   00052 Galactose metabolism
    Mflv_4245
  Energy metabolism
   00680 Methane metabolism
    Mflv_4245
Enzymes [BR:mgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mflv_4245
Protein phosphatases and associated proteins [BR:mgi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mflv_4245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4506427..4507458)
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDARYGSSVVGFLDGWRGLLEDRRVQLKNDDRNDR
LLAKGGTMLGTARTNPDKLRAGLDQIKQTLEDNGIDVLIPIGGEGTLTAAHWLSEEGVPV
VGVPKTIDNDIDCTDVTFGHDTALTIATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGMASGAHMTLIPEQPFDVEEVCRLVKQRFQRGDSHFICVVAEGAKPAEGSMQLRQGGMD
EFGHEKFTGVAAQLAIEVEKRIKKDVRVTVLGHVQRGGTPTAFDRVLATRFGVNAADAAH
AGEYGMMVSARGTEIGRVPLADAVRQLKLVPQTRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggagtgctgaccggcggcggagactgcccaggcctgaacgccgtgatccgg
gcggtggtccgcacctgcgacgcgcgctacggctcgtcggtcgtcggcttcctcgacggc
tggcggggtctgttggaggaccgccgcgtccagctcaagaacgacgaccgcaacgaccgg
ctgctcgccaagggcggcacgatgctgggcaccgcccggactaacccggacaagctgcgc
gccggcctcgaccagatcaagcagacgctggaggacaacgggatcgacgtgctgatcccg
atcggcggcgagggaaccctgaccgctgcgcactggctctccgaggagggcgtgccggtg
gtgggtgtgcccaagacgatcgacaacgacatcgactgcacggacgtgactttcgggcac
gacaccgctctgaccatcgcgaccgaggccatcgaccgcctgcacagcacggccgagtcc
caccagcgcgtcatgctcgtcgaggtgatgggccgccacgccggctggatcgcgctgaac
gcgggcatggcctccggggcgcacatgacgctgatccccgagcagcccttcgatgtcgaa
gaggtgtgcagactggtcaagcagcgcttccagcgcggtgattcgcacttcatctgcgtc
gtcgccgagggcgccaaacccgccgagggttcgatgcagctgcggcagggcggcatggac
gagttcggccacgagaagttcaccggggtcgcggcgcagttggcgatcgaggtcgagaag
cgcatcaagaaggacgtccgcgtcaccgtgctcggtcacgtgcagcgcgggggcaccccg
accgcattcgaccgcgtgctggcgacccgcttcggcgtcaacgccgccgacgcggcgcac
gcgggggagtacgggatgatggtgtcggcccgcggcaccgagatcggccgggtaccgctg
gccgacgccgtgcggcagctcaagctggtcccgcagacgcgctacgacgacgccgccgaa
ttcttcggctga

DBGET integrated database retrieval system