KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4261Help
Entry
Mflv_4261         CDS       T00498                                 

Definition
glycoside hydrolase family protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mflv_4261
Enzymes [BR:mgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mflv_4261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4524905..4526500
Genome map
AA seq 531 aa AA seqDB search
MSHADVVSGDENSSVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAAYLPLIRVLRT
LAAENRRHLITLGITPVVAAQLDDPYCLQGMNHWLANWQLRALEASTTRSSEPGAPPASQ
PQALRQFGVREYDEAERELGEFDALWRHGASPVFRELLDSQTIELLGGPLAHPFQPLLNP
RLREFALREGLADAHARFAHRPSGIWAPECAYAPGMEIGYDDAGVTHFMVDGPSLRGDTS
LGRPVGGSDVVAFGRDLQVSYRVWSPKSGYPGHSAYRDFHTYDHATGLKPARVTGRNVPS
DAKAPYDPARADAAVDVHVADFVDTVRRRLASESERIGRPAHVVAAFDTELFGHWWYEGP
VWLERVLRALPAAGVRVGTLSDAIAEGYVGAPVDLPPSSWGSGKDWQVWSGDQVADLVQL
NSEVVDAALSTVDKALAHGAALGSPTPRDFVADQILRETLLTVSSDWPFMVSKDSAADYA
RYRAHLHAHATREISDALASGRREHAQQLADGWNRADGLFGALDARRLPAP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacgcagacgtcgtgtctggggacgaaaatagttctgtaccaggacttttcacg
ctggttctgcacacgcatctgccgtggctcgcgcatcacggtcgctggccggtcggcgag
gaatggctctatcagtcgtggtcggctgcgtacctgccgctgatacgcgtgctgcgcacg
ctggccgccgagaaccgccgacacctgatcacgctgggcatcaccccggtggtggccgcc
cagttggacgatccgtattgcctgcagggcatgaaccactggctcgcgaactggcaactc
cgggcgctggaggcctcgacgacgcggagctcggagccgggcgccccacccgcatcccag
ccacaggccctgcggcagttcggtgttcgcgaatacgacgaggccgaacgggaactcggc
gagttcgacgcattgtggcggcacggtgcgagcccggtgtttcgcgaactgctcgacagc
cagaccatcgagctgctcggcggcccgctcgcgcacccctttcaaccactgctgaatccg
cgtctgcgcgagttcgcgctacgcgagggtctcgccgatgcccacgcgcgattcgcccac
cgcccgagcgggatctgggcgccggaatgcgcgtacgcaccggggatggaaatcggctac
gacgacgccggtgtcacccacttcatggtcgacgggccgtcgttgcgcggagacacctcg
ctcggccgaccggtcggcggttccgatgtcgtcgcgttcggtcgcgaccttcaggtgagc
taccgcgtgtggtcgcccaaatcgggataccccggacacagcgcctaccgcgacttccac
acctacgaccacgccaccgggctcaaacccgctcgggtgaccggacgtaacgtgccctcg
gacgcgaaggcgccctacgatccggcgcgcgccgacgccgcggtggacgtccatgtcgcc
gacttcgtcgacaccgtgcgccggcgcctcgcctccgagagcgaacgcatcggccggccc
gcccatgtcgtcgccgcgttcgacaccgagctgttcgggcactggtggtacgagggcccg
gtttggctggagcgggtgttgcgggcgctgcccgccgccggcgtgcgggtcggcacgctg
tcggatgcgatcgccgagggctatgtcggcgccccggttgatctcccgccgagctcgtgg
ggctcgggcaaggactggcaggtgtggtcgggcgaccaggtggccgatctggtgcagctc
aacagcgaggtcgtcgacgcggcgctgagcaccgtggacaaggcactcgcccacggtgcg
gcgttgggttcgcccaccccaagggatttcgtggccgaccagatccttcgcgagaccttg
ttgacggtgtcgagtgactggccgttcatggtgagcaaggactccgccgcggactatgcg
cgctaccgcgcccatctgcacgcccacgccacgcgggagatctccgacgcactggcgtcg
ggccgccgcgagcacgcgcagcagctggccgacggctggaatcgcgccgacgggctgttc
ggtgcgctcgacgcccggaggctgccggcgccatga

DBGET integrated database retrieval system