KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4564Help
Entry
Mflv_4564         CDS       T00498                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Mflv_4564
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Mflv_4564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4859155..4860726
Genome map
AA seq 523 aa AA seqDB search
MAEYDVIVVGFGAAGAAAAIEAADRGARVLALDRGYGGGATALSGGIIYAGAGTAEQHAG
GHTDSVDNLRAYLTQEVGDAVGEDTLTRFCAESPGLIAWLKAQGVEFRGGPVSSYKTSYP
TDDFYLYYSGNEKAYPYAQHAAPAPRGHRVLAPGMSSGRVLYERLRDSAKAKGVTVIPLA
RVHGLITDAGRVVGVRYRVLDQGHPNAHRHRVLTRATAKLGTWMPGLVNGVVARAERLWA
EAAVQTEARAPSVILAAGGFIFNREWVQAHAPKFTKISPLGTAGDDGNGIALGLDAGGFT
DKMGNVAAWRFLAPLSAFLEGLTVGADGRRITNEDLYGATHSNVMMREFGGTGWAIYDAR
TWAKIRGQVRTQTQLFQRLQLIYLFTTGHRKSSTLEGLARKNGIDPAGLRRTVDAYNSGI
VSGTGDPAHKDPGLCAPMTTGPFYSIDISAASSMFYPVPGLTLGGLVVDEKTGEVMHRAG
GTVAGLYAVGRTAVGICSNSYVSGLSLSDCVFSGRRAGAHAAG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtacgacgtcatcgtcgtcgggttcggcgccgccggtgcggccgccgcgatc
gaggcggccgaccgcggcgcacgggtcctcgcgctggaccgcggctacggtggcggcgcg
accgcgttgtccggcgggatcatctacgccggcgcaggcaccgccgaacaacacgcgggc
ggccacaccgattccgtcgacaaccttcgggcctacctcacacaggaggtcggcgacgcg
gtcggcgaggacacgctgacacgcttctgtgccgaaagtcccggcctcatcgcatggttg
aaggcgcaaggcgtcgagttccgcggtggacccgtgtcgtcgtacaagacgtcctacccc
accgacgacttctacctctactactcgggcaacgagaaggcctacccctacgctcagcat
gctgccccggcaccgcgcggacaccgcgtgctcgcccccggtatgagttcgggccgagtg
ctctacgagcgcctacgggactcggcgaaagccaagggagtcactgtgattccactggcc
cgcgtccacggtctgatcaccgacgccggccgcgtcgtcggggtgcgataccgcgtgctg
gatcagggccaccccaacgcacaccgtcaccgcgtgctgaccagagccaccgcgaaactg
ggcacgtggatgccgggcctggtcaatggtgtggtggcccgggccgaacggctatgggcc
gaggcagcggtgcagaccgaagcacgcgcgccgtcggtgatcctggccgcgggcggcttc
atcttcaaccgcgagtgggttcaggcgcatgcgccgaagttcacgaagatctccccgctg
ggcaccgccggcgacgatggcaacgggatcgcgctggggctcgacgccggcgggttcacc
gacaagatgggcaacgtcgccgcctggcggttcctcgccccgctcagcgcatttctcgaa
ggcctcaccgtcggcgccgacggccgccggatcaccaacgaggacctttacggcgccaca
cacagcaatgtgatgatgcgcgagttcggcggcaccggatgggcgatctacgacgcgcgc
acatgggcgaagatccgcggtcaggtccggacccagacgcagctgttccagcgtctgcag
ttgatctacctgttcaccaccggacaccgcaagagctccaccctggagggtctggcccgc
aagaacggcatcgacccggccggactgcggcgcaccgtcgatgcctacaactccggaatc
gtctccggtaccggtgatccggcacacaaggaccccggtctgtgtgcgccgatgacgacg
ggaccgttctactcgatcgacatctccgcggcgtcgtcgatgttctatccggtccccggg
ctgacgctcggcgggctggtcgtcgacgagaagaccggcgaggtgatgcaccgcgccggt
ggcaccgtggctgggctgtacgcggtgggacgcaccgcggtcggcatctgctcgaacagc
tacgtcagcggactgtcgttgtcggactgcgtcttcagcggccgccgcgccggagcacac
gcggccgggtag

DBGET integrated database retrieval system