KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4626Help
Entry
Mflv_4626         CDS       T00498                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mflv_4626
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_4626
  Lipid metabolism
   00071 Fatty acid degradation
    Mflv_4626
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mflv_4626
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mflv_4626
   00626 Naphthalene degradation
    Mflv_4626
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mflv_4626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4925548..4926645
Genome map
AA seq 365 aa AA seqDB search
MNADALVLTKPRTLERRHLPVPRIDDESGLLRIEACGLCGTDHEQFSGHLPTGFAFIPGH
EIIGVIEGIGDAARERWGVSVGQRVAVEVFRSCRECDSCGRGEYRRCSSNGLATMFGFVD
VNIPPGLWGGYATHLHLPFDSMPLPVPDGLDPIVATLFNPLGAGIKWAAMLPETSPGDVV
AVLGPGIRGICAAVAAKEAGAAFVAMTGVGPRDRTRLAAAHQFGVDLTIDVTEDDPAQAL
QMATGRLADVVVDVTAKAPAAFADAVALAQPGGRVVVAGTRGGGGAPGFEPDLLVFKELR
IFGSLGVDYPAYQSAIELLVSRRWPFEELHREITGFAGLPRLLDLLAGNEPDRVPALHNV
FVPIA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccgacgcgctcgtgctgaccaagccgcgcacccttgaacggcggcatcttccg
gtgccgcgcatcgacgacgagtccggtctcctgcggatcgaggcgtgcgggctctgcgga
accgaccacgagcagttcagcggacacctgccgacggggttcgccttcatccccggacac
gagatcatcggcgtcatcgagggaatcggtgacgccgcgcgcgagcgttggggcgtctcg
gtgggtcagcgagtcgccgtcgaggtgttccgatcgtgtcgggagtgcgactcgtgcggc
cgcggcgagtatcgcaggtgctcgagcaacggcctcgccaccatgttcggcttcgtcgac
gtgaacatcccgcccggcctgtggggaggctatgcaacccacctgcatctgccgttcgat
tccatgccgttgccggtcccggacggactcgacccgatcgtcgcgacgttgttcaatccg
cttggggcagggatcaaatgggctgccatgttgcccgagacaagcccgggcgacgtcgtc
gcggtcctcggaccagggatccgcgggatttgtgctgccgtagccgccaaggaggccgga
gcggcattcgtcgcgatgaccggggtcggccctcgcgaccgaactcggctagccgcagcc
caccagttcggcgtggacctgaccatcgacgtcaccgaagacgacccggcgcaggccctg
caaatggcgaccggccggctcgcagatgtcgtcgtcgacgtcaccgcgaaggcgccagcc
gcattcgcggacgccgtcgcactcgcgcagcccggcggacgcgtggtggtcgcgggcaca
cgcggcggcggcggagcgccgggcttcgagccagacctgctcgtattcaaggaactacgc
atcttcggttcgttgggggtcgactaccccgcctaccagagcgccatcgagctgctggtc
tctaggcgttggcccttcgaagaattgcaccgcgagatcaccggtttcgccggcctgccc
aggctgctcgaccttctggccggcaacgagccggaccgggtccccgctctgcacaacgtc
tttgtgccgatcgcctga

DBGET integrated database retrieval system