KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4801Help
Entry
Mflv_4801         CDS       T00498                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Mflv_4801
  Amino acid metabolism
   00380 Tryptophan metabolism
    Mflv_4801
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mflv_4801
Enzymes [BR:mgi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Mflv_4801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5109386..5110762)
Genome map
AA seq 458 aa AA seqDB search
MVDHRQPFPPLPHPPRRVPVVGDVFGFSADILTRPPSDPGLGPVFEFRFLGARYVVAASA
DAVAEVNDERRFCKHVGPDIDALRIMGGDGLFTAYNEEPNWQRAHDLLMPAFSQQAMRGY
HSAMLDAADGLVARWDGKARTGASVDVPADATRVTLETIGQCAAGHPFGCFDTEDPHPFV
EHMVAGLKGSDWVGVLRETVLPNFFARRAERRVRRHAVQMHRIADEIVSERLRDGLGHHD
DLLELMLTSDLDPANIRYQLINFLVAGHETTSGALSFALYFLSRHPEVADRARAEVAEVW
GDDERPGFELIAKLRYVRRVLDEALRLQPTVPGYYREAREDTVLAGVHPMRQGDWVLAMT
MALHRDPRWGGDPDAFDPDRFAPDRVRARPAGLYKPFGTGPRSCIGRQFALHEAVLLLAV
LLRRYDLVPEPGYQLQVAQRLTLMPKDFRLTLRRRRSE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaccaccgacagccgtttccgccgctgccacacccgccgcgtcgggtgcccgtc
gtcggtgatgtgttcggcttcagcgccgacatcctcacccggccgccgtcggaccccgga
ctcggcccggtcttcgaattccgtttcctgggagcgcgatacgtggttgccgcgagcgca
gacgccgtggccgaggtcaacgatgagcgccgtttctgcaaacacgtcggccccgacatc
gacgcactccggatcatgggtggcgacggactgttcaccgcgtacaacgaagaaccgaat
tggcaacgggcccatgaccttctgatgcctgcgttcagtcaacaggcgatgcggggctat
cactcggcgatgctggacgcggccgacggactcgtcgcccgctgggatggcaaagcgcgc
accggcgcatcggtcgacgtcccggccgatgcgacccgggtgacgctggagaccatcgga
cagtgcgcggcgggtcatcccttcggctgcttcgacaccgaggatccccacccgttcgtc
gagcacatggtcgccgggctcaaggggtctgactgggtgggggtcctccgggagacggtc
ctgccgaacttctttgcgcgccgcgccgaacggcgggtgcgacgccacgcagtgcagatg
caccgcatcgccgacgagatcgtctccgaacgccttcgcgacggactcgggcaccacgat
gatctgctcgagctgatgctgacctctgacctggatccggccaacatccgctaccagctg
atcaactttctggtcgcgggtcacgaaacaacgtcgggtgcattgtctttcgcgctgtac
tttctgtcccggcatcccgaggtggcggacagggcgcgtgcggaggtcgccgaggtatgg
ggtgacgacgagcgtcccgggttcgagttgatcgccaaactgcgctatgtgcgacgggtg
ctggacgaggcgctgcggctgcagccgaccgtgccggggtactaccgcgaggcgcgtgag
gacacggtgctggccggcgtgcatccgatgcgccagggcgactgggtgctggcgatgacg
atggcgctgcaccgggatccccggtggggcggcgatccggatgcgttcgatcccgaccgg
ttcgcacccgaccgggtccgggcacgtccggcgggtctgtacaaaccgttcggtacgggg
ccgcgatcgtgcatcggccggcagttcgcgctccacgaagcggtgctgctgctggcggtg
ctgctgcgcaggtacgacctcgtccccgagccgggctatcagctccaggtcgcgcagcgg
ctgacgttgatgcccaaggactttcgcctcacgctgcgccggcgacggtcagagtga

DBGET integrated database retrieval system