KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4842Help
Entry
Mflv_4842         CDS       T00498                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
mgi00240  Pyrimidine metabolism
mgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mflv_4842
Enzymes [BR:mgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mflv_4842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-ProteinID: ABP47310
JGI: Mflv4842
UniProt: A4TEW2
Position
complement(5154907..5156238)
Genome map
AA seq 443 aa AA seqDB search
MSFDAAGPISHLDAPSVIRTKRDGGALSDEAIDWVIDAYTRGEVAEAQMSALLMAIFLRG
MTGHEIARWTAAMIASGERLDFSDLRRDGKPLALVDKHSTGGVGDKITIPLVPVVMACGG
AVPQAAGRGLGHTGGTLDKLESIPGFTAEITKSQIRQQLCDLGAAIFAAGELAPADRKIY
ALRDVTATTESLPLIASSVMSKKIAEGTKALVLDSKVGSGAFLDSEAESRELARTMVELG
VEHGVQTRALLTDMQTPLGRTVGNAVEVVESLEVLAGGGPDDVVELTLALAREMCDVAGL
DGVDPAQTLRDGTAMDRFRDLVAAQGGDVDSLDAAMLPLGQHTETISAPRSGTMGDIDAM
AVGLAVWRLGAGRSVPGEQVQFGAGMRIHRKPGEAVAAGEPLFTLYTETPHRLAAAASEL
DGAWSVGDHAPPTRPLIIDRISM
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttcgacgccgccggccccatctcgcatctcgatgctccgtcggtgatccgaacg
aagcgcgatggtggagccctgtccgacgaggccatcgactgggtcatcgacgcctacacg
cgcggggaggtcgccgaggcgcagatgtccgcgctgctgatggcgatcttcctccggggt
atgaccggccatgagatcgcgcggtggaccgcggcgatgatcgcgtcgggcgagcgactg
gacttcagcgacctgcgccgggacgggaagccgctcgcgctggtcgacaaacactcgaca
ggcggtgtcggggacaagatcacgatcccgttggtgccggtcgtcatggcgtgtggcggc
gcggtaccgcaggcggccgggcgtggactcggacacaccggtggcacgctcgacaaactg
gaatccatcccggggttcaccgccgagatcaccaaaagccagatccggcaacaactctgc
gatctcggggcggcgatcttcgccgccggggaattggcgcccgccgaccgcaagatctac
gccctgcgcgacgtgacggcgacgacggagtcgctgccgttgatcgcgagctcggtgatg
agcaagaagatcgccgaggggacgaaggcgctggtgctcgactccaaggtcgggtcgggt
gcgttcctcgacagtgaggccgagtcgcgggagttggctcgcaccatggtcgagctcggc
gtcgagcacggtgtgcagacccgcgcgctgctcaccgacatgcagaccccgctgggccgg
accgtcggcaacgccgtcgaggtcgtcgagtccctggaggtgctcgccggcggcggaccc
gacgatgtcgtggagctgaccctggcgttggcgagggagatgtgcgacgtcgcagggctc
gacggcgtcgaccccgcgcagacgttgcgcgacgggaccgcgatggaccggttccgcgac
ctggtcgccgcccagggtggcgacgtggacagtctcgatgccgcgatgttgccactcggt
cagcacaccgaaaccatcagtgccccgcgcagtggcacgatgggagacatcgacgcgatg
gcggtgggtctggcggtgtggcggctcggagcgggacgctcggtacccggcgagcaggtg
cagttcggcgcggggatgcggatccatcgcaaacccggcgaggccgtcgccgccggcgag
ccgttgttcaccctctacaccgagaccccgcaccggcttgccgccgcggcgtccgaactc
gacggcgcctggagcgtcggcgaccacgcaccgcccacgcgtccactcatcatcgaccgg
atcagcatgtag

DBGET integrated database retrieval system