KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4845Help
Entry
Mflv_4845         CDS       T00498                                 

Definition
putative succinate dehydrogenase
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mflv_4845
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mflv_4845
   00650 Butanoate metabolism
    Mflv_4845
  Energy metabolism
   00190 Oxidative phosphorylation
    Mflv_4845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5157300..5157803
Genome map
AA seq 167 aa AA seqDB search
MTQASRPASGRAENAYDHISDRGGPAPVMQRSFDRPAGLDNPRAPRRSGGMPNFEKYTWL
FMRFSGIVLVFLALGHLFIMLMWENGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGG
NGMRTIIADYTRKDSTKFWLNTLLALSMAFTLVLGTYVLLTFDASIS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaggcaagccgtccggcctccggccgggccgaaaacgcgtacgaccacatctcc
gatcgcggtggacccgccccggtgatgcagcgcagcttcgaccgccccgccgggctggac
aacccgcgcgcgccgcgccgctccggcgggatgccgaacttcgagaagtacacctggctg
ttcatgcggttctcgggcatcgtgctcgtgtttctcgccctgggccacctcttcatcatg
ttgatgtgggagaacggtgtgtaccgcatcgacttcaactacgtcgcgcagcgctggtcg
tcgccgttctggcagacctgggacctgctgctgctgtggctggcccagctgcacggcggc
aacgggatgcgcacgatcatcgccgactacacgcgcaaggactcgacgaagttctggctc
aatactctgctcgcgctgtcgatggcgttcacgctggtcctggggacctacgtgctgctg
acgttcgacgcgtcgatttcctga

DBGET integrated database retrieval system