KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4845Help
Entry
Mflv_4845         CDS       T00498                                 

Definition
putative succinate dehydrogenase
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:mgi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mgi00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mgi00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mgi00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5157300..5157803
Genome map
AA seq 167 aa AA seqDB search
MTQASRPASGRAENAYDHISDRGGPAPVMQRSFDRPAGLDNPRAPRRSGGMPNFEKYTWL
FMRFSGIVLVFLALGHLFIMLMWENGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGG
NGMRTIIADYTRKDSTKFWLNTLLALSMAFTLVLGTYVLLTFDASIS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaggcaagccgtccggcctccggccgggccgaaaacgcgtacgaccacatctcc
gatcgcggtggacccgccccggtgatgcagcgcagcttcgaccgccccgccgggctggac
aacccgcgcgcgccgcgccgctccggcgggatgccgaacttcgagaagtacacctggctg
ttcatgcggttctcgggcatcgtgctcgtgtttctcgccctgggccacctcttcatcatg
ttgatgtgggagaacggtgtgtaccgcatcgacttcaactacgtcgcgcagcgctggtcg
tcgccgttctggcagacctgggacctgctgctgctgtggctggcccagctgcacggcggc
aacgggatgcgcacgatcatcgccgactacacgcgcaaggactcgacgaagttctggctc
aatactctgctcgcgctgtcgatggcgttcacgctggtcctggggacctacgtgctgctg
acgttcgacgcgtcgatttcctga

DBGET integrated database retrieval system