KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4866Help
Entry
Mflv_4866         CDS       T00498                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mflv_4866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_4866
   00620 Pyruvate metabolism
    Mflv_4866
   00640 Propanoate metabolism
    Mflv_4866
  Energy metabolism
   00680 Methane metabolism
    Mflv_4866
Enzymes [BR:mgi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mflv_4866
Lipid biosynthesis proteins [BR:mgi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mflv_4866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5183446..5185143
Genome map
AA seq 565 aa AA seqDB search
MATNTDLFRSARDHLVDVMADYDKALDTFEWPRIAGSFNWATDWFDAIAADPASADRPAL
WIVEEDGREQKVTFAQMAHRSDQVATWLQGLGVGKGDRVILMLGNQVELWESMLAVAKLG
AVIMPTTGALGSEDLADRIRRGGAGYVIANAADAPKFDGVDGDYVRIAVGGGADGWHTYA
DSAHADAHTHDPQTTAGDPLLVYFTSGTTSKPKLVEHSQISYPVGHMTTMAWLGVRPGDV
HLAISAPGWAKHAWSCFFAPWIAEATIFVYNYGRFQAPALLDQIRRAGVNTFCAPPTVWR
MLIQSDLGERPEGLRELLGAGEPLNPEVISAVEQAWGLTIRDGFGQTETTLQIGNTPGQP
VKAGSMGRPMPGVPVVLVDPLTGELADEGEICLDLSGTPLNLMTGYLGDDERNAQVMRDG
YYHTGDVASRDADGYITYIGRTDDVFKSSDYKVSPFELESVLIEHPAVVEAAVVPQPDDT
RLAVPKAYIALADGWSADESTAKAILEHSRDHLAPYLKVRRLEFADLPKTISGKIRRVEL
RRREEDAHRSGAPIESEYRYEDLVN
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaacaccgatctctttcgcagcgcccgcgaccacctggtcgacgtgatggcc
gactacgacaaggcgctcgacaccttcgagtggcctcggatcgccgggtcgttcaactgg
gccaccgactggttcgacgcgatcgccgcagacccggcgtccgccgaccgtccggcgctg
tggatcgtcgaggaggacggccgtgagcagaaggtcaccttcgcccagatggcgcaccgc
tccgaccaggtcgcgacctggctgcagggtctcggcgtcggcaagggtgaccgcgtcatc
ctgatgctcggcaatcaggtggagctgtgggagtcgatgctcgccgtcgccaagctcggc
gcggtgatcatgccgacgaccggagccctcggttccgaagacctcgccgaccggatccgg
cgcggcggcgcgggctacgtcatcgcgaatgcggccgacgcgccgaagttcgacggcgtc
gacggcgactacgtccgcatcgccgtcgggggcggcgcagacggctggcacacctacgcc
gactccgcccacgccgacgcccacacccacgacccgcagaccaccgccggcgacccgctg
ctggtctacttcacctccggcaccaccagcaagcccaaactcgtcgagcactcccagatc
agctatccggtcgggcacatgacgaccatggcgtggctcggcgtgcggcccggcgacgtc
catctggcgatcagcgcgcccggctgggccaaacacgcgtggagctgcttcttcgcgccg
tggatcgcggaagcgacgatcttcgtctacaactacggacgcttccaggcaccggccctg
ctggaccagatccggcgcgccggggtgaacacgttctgcgcgccgccgacggtgtggcgc
atgctgatccagtccgacctcggcgagcgccccgaaggtctgcgcgaactgctcggcgcc
ggcgagccgctcaatcccgaggtgatcagcgcggtcgaacaggcgtgggggctgaccatc
cgcgacgggttcggccagaccgagacgacgctgcagatcggcaacactcccggccagccg
gtcaaggccggctcgatgggccgcccgatgcccggtgtgcccgtcgtgctggtggatccg
ctgaccggagagctcgccgacgaaggcgaaatctgcctcgacctgagcgggacgccgctg
aacctgatgaccgggtacctcggcgacgacgagcgcaacgcccaggtgatgcgcgacggt
tactaccacacgggcgacgtcgcaagccgggacgccgacggctacatcacctacatcgga
cgcaccgacgacgtcttcaaatcctcggactacaaggtgtcgccgttcgagctggaaagc
gtactcatcgagcatcccgcggtcgtcgaggccgccgtggtcccccagcccgacgacacc
cgcctggccgtgccgaaggcctacatcgcgctggccgacggatggtcggccgacgagagc
accgccaaggcgatcctcgagcactcgcgcgaccatctcgccccgtacctgaaggtgcgg
cggctggagttcgccgacctgcccaagaccatctcgggcaagatccgccgtgtcgaactg
cgtcgccgcgaggaggacgcgcaccgctccggtgcgccgatcgaatccgagtaccgctac
gaggatctggtgaactga

DBGET integrated database retrieval system