KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4987Help
Entry
Mflv_4987         CDS       T00498                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mgi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mgi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mgi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mgi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mgi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5305603..5306550)
Genome map
AA seq 315 aa AA seqDB search
MSGTAAIVTLTMNTALDVTADADNVVPTEKIRCRAERYDAGGGGVNVARFAHALGAPVSA
VFTAGGSTGARVIDLVHATGVCEIPVLIEGGTRESFTVNDRASGRQYRFVLPGPVLSLGE
QARCLEALRRAAGTAGIVVASGSLPPGVPPDFYQRVADICSDVGAMLVLDTSGGGLRHVT
SGVHLLKPSIRELRECLDRPLHTEPEQIAAARELIDRGAAKVVVVSLGADGALLVTPDDS
ERLSAVPMTSVSCVGAGDALVAGVAVGLARRWPLGRAVRFGIAAASAKLQTPGTAAFHRD
DVERYFVTQAAHSEA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacggctgcgatcgtgacgttgacgatgaacaccgcgctcgacgtcaccgcc
gatgcggacaatgtcgttccgacggagaagatccgttgtcgcgcagagcgatacgatgcc
ggcggcggtggggtcaacgtggcccgcttcgcccacgcactgggtgccccggtgtcggcg
gtgttcaccgccggtggatccaccggcgcccgcgtgatcgacctcgtgcatgccaccggg
gtctgcgagattccggtcctcatcgagggtggcacccgggagagcttcaccgtcaacgat
cgggccagtggtcggcagtatcgcttcgtactccccggtcccgtgctcagtctcggtgaa
caggcgcggtgcctggaggcgcttcgacgcgctgcgggcacagccgggatcgtcgtcgcg
agcggaagccttccgccgggggtgccgcccgacttctatcagcgtgtcgccgacatctgc
agtgacgtcggcgcaatgctggttctggacacgtccggaggcggattgcgccacgtcacc
tccggggtgcacctgctcaagccgagcatccgggagcttcgcgaatgcctggatcggccg
ctgcacacggaacccgaacaaatcgccgccgcacgcgaactcatcgaccgaggtgcggcc
aaagttgtggtggtgtctctgggcgcagacggggcactgctggtcacacccgatgacagc
gaacgcctttcagccgtcccgatgacctcggtcagttgtgtgggcgcgggcgatgcgctg
gtcgccggagtcgccgtcgggcttgcgcgccgctggcccctcgggcgggcggtgcggttc
ggaatcgccgccgcctcagcgaagctgcagacgccgggcaccgcggcgttccaccgcgac
gacgtcgagcgctatttcgtcacgcaggcggcacattcggaggcctga

DBGET integrated database retrieval system