KEGG   Mycobacterium gilvum PYR-GCK: Mflv_4987Help
Entry
Mflv_4987         CDS       T00498                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mgi  Mycobacterium gilvum PYR-GCK
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mflv_4987
   01230 Biosynthesis of amino acids
    Mflv_4987
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mflv_4987
   00030 Pentose phosphate pathway
    Mflv_4987
   00051 Fructose and mannose metabolism
    Mflv_4987
   00052 Galactose metabolism
    Mflv_4987
  Energy metabolism
   00680 Methane metabolism
    Mflv_4987
Enzymes [BR:mgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mflv_4987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5305603..5306550)
Genome map
AA seq 315 aa AA seqDB search
MSGTAAIVTLTMNTALDVTADADNVVPTEKIRCRAERYDAGGGGVNVARFAHALGAPVSA
VFTAGGSTGARVIDLVHATGVCEIPVLIEGGTRESFTVNDRASGRQYRFVLPGPVLSLGE
QARCLEALRRAAGTAGIVVASGSLPPGVPPDFYQRVADICSDVGAMLVLDTSGGGLRHVT
SGVHLLKPSIRELRECLDRPLHTEPEQIAAARELIDRGAAKVVVVSLGADGALLVTPDDS
ERLSAVPMTSVSCVGAGDALVAGVAVGLARRWPLGRAVRFGIAAASAKLQTPGTAAFHRD
DVERYFVTQAAHSEA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacggctgcgatcgtgacgttgacgatgaacaccgcgctcgacgtcaccgcc
gatgcggacaatgtcgttccgacggagaagatccgttgtcgcgcagagcgatacgatgcc
ggcggcggtggggtcaacgtggcccgcttcgcccacgcactgggtgccccggtgtcggcg
gtgttcaccgccggtggatccaccggcgcccgcgtgatcgacctcgtgcatgccaccggg
gtctgcgagattccggtcctcatcgagggtggcacccgggagagcttcaccgtcaacgat
cgggccagtggtcggcagtatcgcttcgtactccccggtcccgtgctcagtctcggtgaa
caggcgcggtgcctggaggcgcttcgacgcgctgcgggcacagccgggatcgtcgtcgcg
agcggaagccttccgccgggggtgccgcccgacttctatcagcgtgtcgccgacatctgc
agtgacgtcggcgcaatgctggttctggacacgtccggaggcggattgcgccacgtcacc
tccggggtgcacctgctcaagccgagcatccgggagcttcgcgaatgcctggatcggccg
ctgcacacggaacccgaacaaatcgccgccgcacgcgaactcatcgaccgaggtgcggcc
aaagttgtggtggtgtctctgggcgcagacggggcactgctggtcacacccgatgacagc
gaacgcctttcagccgtcccgatgacctcggtcagttgtgtgggcgcgggcgatgcgctg
gtcgccggagtcgccgtcgggcttgcgcgccgctggcccctcgggcgggcggtgcggttc
ggaatcgccgccgcctcagcgaagctgcagacgccgggcaccgcggcgttccaccgcgac
gacgtcgagcgctatttcgtcacgcaggcggcacattcggaggcctga

DBGET integrated database retrieval system