KEGG   Malassezia globosa: MGL_0012Help
Entry
MGL_0012          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
mgl  Malassezia globosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MGL_0012
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGL_0012
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MGL_0012
Enzymes [BR:mgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MGL_0012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 660 aa AA seqDB search
MALERGGADVIELGMPFSDPQADGPAIQESNRIALQQGVDYAMCLKYIKEARSRGLKVPV
VLMGYYNPIMAYGEERAVHDAKSAGANGFILVDLLPEEAGTFLNACRREKMAFVPLIAPT
TDVNRIRYLSSLADAFIYVVSRLGTTGVSASVSSSLGELMSRIRSATDSPLAVGFGVSTR
EHFIEVGALSEGVVIGSKLVQCLKESEATTEARAKAAFEFCDGITGKSQGGLPRAKPLVV
KPPMSTHVAPASSVAKEARFGDFGGQFIPEALVQCHRELEQAYNAVRTDPTFWKEYRDQF
NYIGRPSELYLAKRLSEWAGGAQIWLKREDLNHTGSHKINNAIGQVLLAKRLGKTRIIAE
TGAGQHGVATATACAKFGLECVVYMGAEDVRRQSLNAFRIRMLGAKLIAVESGSKTLKDA
INEANRDWVSNIHNTHYLVGSAIGPHPFPTLVRDLQSVIGEETKKQLQEQAGCLPNAVLA
CVGGGSNAIGMFHPFVNDESVRLIGVEAGGQGVDTPYHSATLAAGKVGVLHGVRTYLLQD
KDGQVIETHSISAGLDYPGVGPEHAYLKDKGRAEYMVATDSQALLGFKWLTEQEGIIPAL
ETSHALYQAVMLAKTMQPEQHIVVSLSGRGDKDVEQVADGLSKQGWGDAIEWSLPSLIHK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggaacggggtggcgctgatgttattgagcttggcatgccattctccgaccct
caggcagatgggccagcgattcaggagagtaaccgtattgctttgcagcaaggtgtagat
tatgccatgtgcttgaaatatatcaaggaggcacggtcgagagggctaaaagtacctgtg
gtgttaatgggctattataacccgatcatggcttatggtgaagaacgcgcagttcacgat
gcaaaatcggcgggtgccaatggtttcatcctggtggatcttttgcccgaggaggctggt
accttcttgaacgcttgtcgcagggaaaaaatggcatttgtgccactcattgcaccaacc
accgatgttaaccggattcgctacttatcttcactcgctgatgcatttatatatgtggta
tcgcgtcttggtacgactggtgtatcggcctctgtatcaagctcgttgggcgagctcatg
tctagaatccgctcggcgacagactcaccactcgctgtaggctttggcgtttcaacacgg
gagcactttatcgaggttggtgctctctcggagggtgttgtcatcggaagcaaacttgtt
caatgtctgaaggaatcggaggctaccaccgaagcacgtgcgaaagcggctttcgagttc
tgcgatggcatcactggaaaaagtcagggcggcctgccacgcgccaagccccttgttgtt
aagccaccaatgagcacccatgttgcacccgcgagtagtgttgcgaaagaagcccgattc
ggtgattttggtggtcagttcatccctgaggcgctcgtccagtgccatcgggaactagag
caagcgtacaatgctgtccgcacagaccctactttttggaaggagtaccgcgatcagttc
aactatattgggcgacctagtgaactgtatttggcgaaacgcctgtcagaatgggctggc
ggtgctcaaatctggctgaaacgtgaagatttgaaccatacaggaagccacaagatcaac
aatgctatcggacaggtcctgctcgctaagagactaggaaagactcgcattatcgcagaa
actggtgctggtcagcatggtgtggctactgctacggcgtgtgccaaattcggcctggag
tgtgttgtgtacatgggtgctgaggatgttcgacgtcaatcgttgaatgcgttccgcatc
cgtatgctgggagctaagctcatcgctgttgagagtgggagcaagacgctcaaggatgcg
atcaatgaagcaaatcgcgactgggtatcgaacattcacaatacgcactatcttgttggc
tcagcaattggaccacatccattccccactcttgtgcgtgatttgcaatcagtcattgga
gaagagacaaaaaagcaactgcaggaacaagcaggctgtctcccaaatgccgttcttgcg
tgtgtcggtggtggcagcaatgccattggcatgttccatccattcgttaatgacgaatct
gtacgcctcattggcgttgaagctggtggtcagggtgtcgatactccgtatcattcggct
accttggccgctggcaaggttggagtattgcatggcgtacgaacgtacctgctgcaggat
aaagatggtcaagtaatcgagacgcactcgatcagcgctggacttgactatccgggtgta
ggtcctgagcatgcgtatctaaaagacaagggacgtgcggagtatatggtggcaactgat
tcgcaagcactgctaggctttaaatggcttactgaacaagagggcattatacctgcactt
gaaacgagtcacgcactgtatcaggcagtaatgctggccaaaaccatgcagcctgagcag
cacattgtcgtgagtctgagtggccgtggcgataaggacgttgagcaagtggccgatgga
ctcagtaaacaaggctggggcgatgctattgagtggtctttaccttccttgatacacaag
taa

DBGET integrated database retrieval system