KEGG   Malassezia globosa: MGL_0026Help
Entry
MGL_0026          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MGL_0026
Protein kinases [BR:mgl01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   MGL_0026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1219 aa AA seqDB search
MSHDASTMGGNMGSAHGSGNLNTSYLQTPPRNYLRQQQPTLLTPTMHPQRSPQVNQPITM
TSSPWSTSPRQSDASLSPKGLYDRRDQVGLGELTTPRWMMSHGHPDADFPQRLLPLDSPA
YTGSVFANTSGGTGDLSTPGVAATRDRNSAREKSARAISYSLSNTNHASSSKLMPSFSSM
QFDEAPVDFPSPPIEPYEVSSYETPARRADRRWKPSTACTASVANGVDGAGTSAATGSSA
SAVPAGAAGTPPAPPPASMPVQMENSLHSPPVHGSLTDITDNMYHMNMSPLSTPQTQSSS
LDVFLDNPAQSPFQSQSHTQVQPPYLKVHPQTHSSQASFVASSVPSSSIPSQERAGFSRV
EEQAGPDHSRWSVAPARAPPSPSVLPSGMTFSEAAVPTSETSSPRVPKSPRWRQRAVSRV
DDTDESSSLAGRLSRRSLVALSSFFKSSPRRTTKDVSDANAGSAGGSTGNGTTAMPSAVA
YSSAKVATPEPSTPPSRSRLSFSRRRRQSLQHVRNSLARQARADQPGVPDVPHVRDTPNT
RASTGANLSTPTKYAPNLPPKSSRREGADVVVPLRTEPSPYYTAKAQGSRIPRASSMMRI
LRRKSGDQDDLRESRLPVSSSMQSISSASESPFVSLRSNNNQNNAGQRSEQRPLRTSSRK
AVEASPVKARTLRKSQASAEAAEALRRQQTAQTNSDVGMSTTSLSIPATSTNANATSVQE
TARSHASRTPSMASSMLESGIPVPTDVRRRPPSAQSRRSIRVSVDDSQAGDDEMERHIQR
VFRRKLAGGARYEDLEKQLAFPQPTAATKRLSPRQAEVIYGNHMCPYELQEIHQYDSIYY
VGSYARHKHYAVPEKTDRNYGYDDERGDYIVNLRDHLAYRYEILKSLGRGSFGQVLQCRD
HKTGQYVAIKLIRNKRRFHHQAVVEVRIMEHLTRADPDGQHHVVHMTDSFTFRHHLCVTM
ELLSINLYELIKANSFEGFSATLIRRFTLQTLQCLALMRQARIVHCDLKPENILLVHPRR
SEIRVIDFGSSCYEDEKVYTYIQSRFYRSPEVILGMEYNMAIDMWSLGCILVELFTGYPI
FPGENEHDQLACIMEVLGLPDRHLLEKSTRTKLFFDSTGAPRPVVTSRGQKRRPQSKPLA
SVLRTNDEWFLDFVARCLTWDPERRIKADAALHHPWFVHRADSVIPRLPQTRRLTRPDTA
RSLESGSLLPRATPASHRS
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgatgccagcacaatgggtggcaatatggggagtgcacatgggagtggcaac
ttgaacacgtcgtaccttcaaacaccgcctcgaaattacttgcgccagcagcagccgacc
ttgcttacaccgactatgcacccacaaagaagtccgcaagtgaaccagccgataacaatg
acatcatcgccgtggagcacatcacctcgtcagtcagatgcctccttatcacccaagggc
ttgtatgatcgacgggatcaagtcgggctcggtgaactcacaacaccgcgatggatgatg
tcacatggccatccagatgcagattttccgcagcgacttcttcctctcgattcgcctgca
tatactgggagtgttttcgcaaataccagtggcggaactggtgatctcagcacacctggc
gttgcagccacgcgtgatcggaacagtgcgagggagaagagtgcacgcgctatttcatat
tctctgagtaatacgaatcatgcttcgagcagtaaattgatgccttcattttcatcgatg
caattcgacgaagcgcctgttgactttccatctccgccaatcgagccatatgaggtgtca
tcctatgaaacaccagcacgtcgtgcagataggcgttggaagccttcgactgcatgtaca
gcttcagtagcaaacggagtcgatggtgcgggcacaagtgcagctacaggcagttctgcc
agcgctgtgccggcgggggccgccggcacgcctccagcaccgccgccggcatctatgcct
gtacaaatggaaaattcgttacactcaccacccgttcatggctcgttgacagatattacg
gataacatgtaccacatgaacatgtcgcctttgtcaacgccgcaaacacagtccagcagc
ttggacgtgtttctagacaacccagctcagtcgccgtttcagtctcagtctcacacacag
gtgcaaccgccttatttaaaagttcatccacaaacacattcatctcaagcatcgtttgtc
gcgtcgtctgtgccatcttcatctatcccttcacaagaacgcgcaggattttcgcgtgtg
gaagagcaggctggaccggatcattctcgctggagcgtagcaccggctcgagcgccgcca
agtccctcggttcttccatcaggcatgaccttctcagaggcagctgtacctacatctgaa
acgagctcgccacgtgtaccgaaatcaccaagatggcggcagcgtgcagtttctcgcgtg
gacgatacggacgaatcgagctccttggctggtcgactctcgcgccgctcactcgtagca
ctcagctctttctttaaatcaagtccgcgtcgcacgacaaaagatgtttctgacgcgaac
gcgggaagtgctggtggcagcactggtaatggtactaccgccatgccatctgcagttgca
tactcctcagcaaaagtggcgacgccagaaccatccacgccaccgtcccgttcacgactc
tcattctcgcgccgccgacgccaaagcctacagcatgtccgcaattcccttgctcgacaa
gcacgcgccgatcagcctggcgtacccgatgtgcctcatgtgcgtgacacacccaacacg
cgtgcatcgacaggcgcgaacttaagtactccaacgaaatatgcgccaaatcttccccct
aagtcatcacgtcgcgagggtgctgacgtcgttgtgcctctgcgcacagagccttcgcct
tattacacagccaaggcacagggtagtcgtattccccgtgcttcatcgatgatgcggatt
ctcagacgaaagtcgggtgatcaggatgatctgcgtgaatcacgcttgccagtcagttca
tcaatgcaaagcatcagctcggcgtccgagtcgccttttgtatcgcttcgcagcaataac
aaccagaataatgcaggacagcgctcagaacagcggccactgcgcacgtcgtctcgtaaa
gcagtggaagcatcacccgtgaaagctcgcactttgcgcaagtcacaagcaagtgctgaa
gcagcagaagcgcttcgtcgacagcagactgcacagacaaactctgacgttggcatgtca
acgacatcgttgtcgatcccagcgacatcaactaatgcaaatgctacatcagttcaagaa
actgctcgttctcatgcttctcgcacaccatcaatggcatcaagcatgctggaatcggga
atccctgtgccaacagatgtgcgccgccgtccaccaagtgctcagtcacgccggtcgatt
cgtgtgtctgtggacgactctcaagctggtgacgacgagatggaacggcatattcaacgc
gtgttccgtcgaaaacttgcaggtggtgcgcggtatgaggaccttgagaagcagctcgca
ttcccccaaccgacagcagcaaccaaacgtctatcgcctcggcaggccgaggtgatttat
ggaaaccacatgtgtccatatgagctgcaagagatccatcaatatgattccatttattat
gtcggctcgtatgcgcggcacaagcactatgcagtgccggagaagaccgatcggaactat
ggctacgacgacgagcggggtgactatatcgtgaaccttcgagatcatcttgcataccga
tacgaaatcctcaagtcattaggtcggggcagttttgggcaggtcctacaatgccgcgac
cacaagaccgggcagtatgtggccatcaagctgattcgcaataagcgccgcttccatcac
caggcagtggtggaggttcggatcatggaacatcttacacgagcggatcccgatggccaa
caccatgttgttcacatgacagattcgtttacgtttcggcaccatctgtgtgtcacaatg
gagcttttgagcatcaacctctacgagttaatcaaagcgaacagttttgaaggcttctca
gcgactctgatccgccgcttcacattacagacgctccaatgcttggcacttatgcgccaa
gctaggattgttcactgtgatttgaagccagaaaatattctcctcgtacatccacggcgt
agtgaaattcgtgtgattgactttggttcgagctgctacgaggatgaaaaggtatatacg
tacatccagagccgcttctaccgttcacctgaagtgattttgggcatggagtataacatg
gctattgacatgtggagcctgggctgtattttagttgagctttttacgggatacccaatt
tttcctggagaaaatgaacatgaccagcttgcatgcatcatggaagtattaggcctacca
gaccgtcatctactggaaaagagcacgcgaacgaaactatttttcgatagcacaggtgcg
ccaaggcctgtggtcacatcgcgaggacaaaagcggcgtccgcaatcaaaaccacttgcg
tccgttctgcgcacgaatgacgaatggtttcttgacttcgtggcgcgatgcctcacatgg
gatcctgagcgccgcatcaaggctgatgcagccctacatcatccatggttcgtgcatcgc
gcggattccgttattccgcgtcttcctcaaacccgacgcttaactcggcctgacacagcg
cgttctttagagtcaggttcattgctgccacgcgctacgcctgcatcccatcgttcgtag

DBGET integrated database retrieval system